KEGG   Homo sapiens (human): 114609Help
Entry
114609            CDS       T01001                                 

Gene name
TIRAP, BACTS1, Mal, MyD88-2, wyatt
Definition
(RefSeq) TIR domain containing adaptor protein
  KO
K05403  toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05133  Pertussis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06121  TLR signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06263  Hepatocellular carcinoma
  Element
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
N00557  HBV HBe to TLR2/4-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    114609 (TIRAP)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    114609 (TIRAP)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114609 (TIRAP)
  09171 Infectious disease: bacterial
   05133 Pertussis
    114609 (TIRAP)
   05152 Tuberculosis
    114609 (TIRAP)
  09172 Infectious disease: viral
   05161 Hepatitis B
    114609 (TIRAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR_2 TIR
Motif
Other DBs
NCBI-GeneID: 114609
NCBI-ProteinID: NP_001034750
OMIM: 606252
HGNC: 17192
Ensembl: ENSG00000150455
Vega: OTTHUMG00000140373
Pharos: P58753(Tbio)
UniProt: P58753 A0A024R3M4
LinkDB All DBs
Structure
PDB: 

Position
11q24.2
AA seq 221 aa AA seqDB search
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcgacctccctcccagctcctggctctcggcctaagaagcctctaggcaag
atggctgactggttcaggcagaccctgctgaagaagcccaagaagaggcccaactcccca
gaaagcacctccagcgatgcttcacagcctacctcacaggacagcccactacccccaagc
ctcagctcagtcacgtctcccagcctgccacccacacatgcgagtgacagtggcagtagt
cgctggagcaaagactatgacgtctgcgtgtgccacagtgaggaagacctggtggccgcc
caggacctggtctcctacttggaaggcagcactgccagcctgcgctgcttcctgcaactc
cgggatgcaaccccaggcggcgctatagtgtccgagctgtgccaggcactgagcagtagt
cactgccgggtgctgctcatcacgccgggcttccttcaggacccctggtgcaagtaccag
atgctgcaggccctgaccgaggctccaggggccgagggctgcaccatccccctgctgtcg
ggcctcagcagagctgcctacccacctgagctccgattcatgtactacgtcgatggcagg
ggccctgatggtggctttcgtcaagtcaaagaagctgtcatgcgttatctgcagacactc
agttga

DBGET integrated database retrieval system