KEGG   Homo sapiens (human): 114907Help
Entry
114907            CDS       T01001                                 

Gene name
FBXO32, Fbx32, MAFbx
Definition
(RefSeq) F-box protein 32
  KO
K10305  F-box protein 25/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114907 (FBXO32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    114907 (FBXO32)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     114907 (FBXO32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Elongin_A F-box-like
Motif
Other DBs
NCBI-GeneID: 114907
NCBI-ProteinID: NP_478136
OMIM: 606604
HGNC: 16731
Ensembl: ENSG00000156804
Vega: OTTHUMG00000164981
Pharos: Q969P5(Tbio)
UniProt: Q969P5 A0A024R9F3
LinkDB All DBs
Position
8q24.13
AA seq 355 aa AA seqDB search
MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVA
AKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
YVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTL
VQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRL
SDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
VRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccattcctcgggcaggactggcggtcccccgggcagaactgggtgaagacggccgac
ggctggaagcgcttcctggatgagaagagcggcagtttcgtgagcgacctcagcagttac
tgcaacaaggaggtatacaataaggagaatcttttcaacagcctgaactatgatgttgca
gccaagaagagaaagaaggacatgctgaatagcaaaaccaaaactcagtatttccaccaa
gaaaaatggatctatgttcacaaaggaagtactaaagagcgccatggatattgcaccctg
ggggaagctttcaacagactggacttctcaactgccattctggattccagaagatttaac
tacgtggtccggctgttggagctgatagcaaagtcacagctcacatccctgagtggcatc
gcccaaaagaacttcatgaatattttggaaaaagtggtactgaaagtccttgaagaccag
caaaacattagactaataagggaactactccagaccctctacacatccttatgtacactg
gtccaaagagtcggcaagtctgtgctggtcgggaacattaacatgtgggtgtatcggatg
gagacgattctccactggcagcagcagctgaacaacattcagatcaccaggcctgccttc
aaaggcctcaccttcactgacctgcctttgtgcctacaactgaacatcatgcagaggctg
agcgacgggcgggacctggtcagcctgggccaggctgcccccgacctgcacgtgctcagc
gaagaccggctgctgtggaagaaactctgccagtaccacttctccgagcggcagatccgc
aaacgattaattctgtcagacaaagggcagctggattggaagaagatgtatttcaaactt
gtccgatgttacccaaggaaagagcagtatggagatacccttcagctctgcaaacactgt
cacatcctttcctggaagggcactgaccatccgtgcactgccaataacccagagagctgc
tccgtttcactttcaccccaggactttatcaacttgttcaagttctga

KEGG   Homo sapiens (human): 26260Help
Entry
26260             CDS       T01001                                 

Gene name
FBXO25, FBX25
Definition
(RefSeq) F-box protein 25
  KO
K10305  F-box protein 25/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    26260 (FBXO25)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26260 (FBXO25)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26260 (FBXO25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Elongin_A F-box
Motif
Other DBs
NCBI-GeneID: 26260
NCBI-ProteinID: NP_904357
OMIM: 609098
HGNC: 13596
Ensembl: ENSG00000147364
Vega: OTTHUMG00000090341
Pharos: Q8TCJ0(Tbio)
UniProt: Q8TCJ0
LinkDB All DBs
Position
8p23.3
AA seq 367 aa AA seqDB search
MPFLGQDWRSPGWSWIKTEDGWKRCESCSQKLERENNRCNISHSIILNSEDGEIFNNEEH
EYASKKRKKDHFRNDTNTQSFYREKWIYVHKESTKERHGYCTLGEAFNRLDFSSAIQDIR
RFNYVVKLLQLIAKSQLTSLSGVAQKNYFNILDKIVQKVLDDHHNPRLIKDLLQDLSSTL
CILIRGVGKSVLVGNINIWICRLETILAWQQQLQDLQMTKQVNNGLTLSDLPLHMLNNIL
YRFSDGWDIITLGQVTPTLYMLSEDRQLWKKLCQYHFAEKQFCRHLILSEKGHIEWKLMY
FALQKHYPAKEQYGDTLHFCRHCSILFWKDYHLALLFKDSGHPCTAADPDSCFTPVSPQH
FIDLFKF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgccatttttgggtcaggactggagatctcctggatggagttggattaagacagaagat
ggctggaagagatgtgaatcttgtagtcagaaacttgaaagagagaataaccgttgtaac
atcagtcacagcattatcttaaatagtgaagatggagaaatattcaataatgaagagcat
gaatatgcatcgaaaaaaaggaaaaaggaccattttagaaatgacacaaatactcaaagt
ttttatcgtgaaaaatggatctatgtccataaagaaagcacaaaggaaaggcatggctat
tgcaccttgggagaagcctttaatcggttagacttctcaagtgcaattcaagatatccga
aggttcaattatgtggtcaaactgttgcagctaattgcaaaatcccagttaacttcattg
agtggcgtggcacagaagaattacttcaacattttggataaaatcgttcaaaaggttctt
gatgaccaccacaatcctcgcttaatcaaagatcttctgcaagacctaagctctaccctc
tgcattcttattagaggagtagggaagtctgtattagtgggaaacatcaatatttggatt
tgccgattagaaactattctcgcctggcaacaacagctacaggatcttcagatgactaag
caagtgaacaatggcctcaccctcagtgaccttcctctgcacatgctgaacaacatccta
taccggttctcagacggatgggacatcatcaccttaggccaggtgacccccacgttgtat
atgcttagtgaagacagacagctgtggaagaagctttgtcagtaccattttgctgaaaag
cagttttgtagacatttgatcctttcagaaaaaggtcatattgaatggaagttgatgtac
tttgcacttcagaaacattacccagcgaaggagcagtacggagacacactgcatttctgt
cggcactgcagcattctcttttggaaggactaccatcttgctttactattcaaggactca
ggacacccctgcacggcggccgaccctgacagctgcttcacgcctgtgtctccgcagcac
ttcatcgacctcttcaagttttaa

DBGET integrated database retrieval system