KEGG   Homo sapiens (human): 115004Help
Entry
115004            CDS       T01001                                 

Gene name
CGAS, C6orf150, MB21D1, h-cGAS
Definition
(RefSeq) cyclic GMP-AMP synthase
  KO
K17834  cyclic GMP-AMP synthase [EC:2.7.7.86]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa05163  Human cytomegalovirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06134  CGAS-STING signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00395  cGAS-STING signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    115004 (CGAS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    115004 (CGAS)
   05168 Herpes simplex virus 1 infection
    115004 (CGAS)
   05163 Human cytomegalovirus infection
    115004 (CGAS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.86  cyclic GMP-AMP synthase
     115004 (CGAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mab-21
Motif
Other DBs
NCBI-GeneID: 115004
NCBI-ProteinID: NP_612450
OMIM: 613973
HGNC: 21367
Ensembl: ENSG00000164430
Vega: OTTHUMG00000015034
Pharos: Q8N884(Tbio)
UniProt: Q8N884
LinkDB All DBs
Structure
PDB: 

Position
6q13
AA seq 522 aa AA seqDB search
MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSR
QKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSAPGAEGLEPPAAREPALSRAGS
CRQRGARCSTKPRPPPGPWDVPSPGLPVSAPILVRRDAAPGASKLRAVLEKLKLSRDDIS
TAAGMVKGVVDHLLLRLKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQLE
EYSNTRAYYFVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKR
KRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLV
PKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQL
KERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKL
ENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcagccttggcacggaaaggccatgcagagagcttccgaggccggagccactgccccc
aaggcttccgcacggaatgccaggggcgccccgatggatcccaccgagtctccggctgcc
cccgaggccgccctgcctaaggcgggaaagttcggccccgccaggaagtcgggatcccgg
cagaaaaagagcgccccggacacccaggagaggccgcccgtccgcgcaactggggcccgc
gccaaaaaggcccctcagcgcgcccaggacacgcagccgtctgacgccaccagcgcccct
ggggcagaggggctggagcctcctgcggctcgggagccggctctttccagggctggttct
tgccgccagaggggcgcgcgctgctccacgaagccaagacctccgcccgggccctgggac
gtgcccagccccggcctgccggtctcggcccccattctcgtacggagggatgcggcgcct
ggggcctcgaagctccgggcggttttggagaagttgaagctcagccgcgatgatatctcc
acggcggcggggatggtgaaaggggttgtggaccacctgctgctcagactgaagtgcgac
tccgcgttcagaggcgtcgggctgctgaacaccgggagctactatgagcacgtgaagatt
tctgcacctaatgaatttgatgtcatgtttaaactggaagtccccagaattcaactagaa
gaatattccaacactcgtgcatattactttgtgaaatttaaaagaaatccgaaagaaaat
cctctgagtcagtttttagaaggtgaaatattatcagcttctaagatgctgtcaaagttt
aggaaaatcattaaggaagaaattaacgacattaaagatacagatgtcatcatgaagagg
aaaagaggagggagccctgctgtaacacttcttattagtgaaaaaatatctgtggatata
accctggctttggaatcaaaaagtagctggcctgctagcacccaagaaggcctgcgcatt
caaaactggctttcagcaaaagttaggaagcaactacgactaaagccattttaccttgta
cccaagcatgcaaaggaaggaaatggtttccaagaagaaacatggcggctatccttctct
cacatcgaaaaggaaattttgaacaatcatggaaaatctaaaacgtgctgtgaaaacaaa
gaagagaaatgttgcaggaaagattgtttaaaactaatgaaataccttttagaacagctg
aaagaaaggtttaaagacaaaaaacatctggataaattctcttcttatcatgtgaaaact
gccttctttcacgtatgtacccagaaccctcaagacagtcagtgggaccgcaaagacctg
ggcctctgctttgataactgcgtgacatactttcttcagtgcctcaggacagaaaaactt
gagaattattttattcctgaattcaatctattctctagcaacttaattgacaaaagaagt
aaggaatttctgacaaagcaaattgaatatgaaagaaacaatgagtttccagtttttgat
gaattttga

DBGET integrated database retrieval system