KEGG   Homo sapiens (human): 115330Help
Entry
115330            CDS       T01001                                 

Gene name
GPR146, PGR8
Definition
(RefSeq) G protein-coupled receptor 146
  KO
K08431  G protein-coupled receptor 146
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    115330 (GPR146)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    115330 (GPR146)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Rab5ip
Motif
Other DBs
NCBI-GeneID: 115330
NCBI-ProteinID: NP_001290402
HGNC: 21718
Ensembl: ENSG00000164849
Vega: OTTHUMG00000023934
Pharos: Q96CH1(Tdark)
UniProt: Q96CH1 A4D2Q3 B4DTD6
LinkDB All DBs
Position
7p22.3
AA seq 333 aa AA seqDB search
MWSCSWFNGTGLVEELPACQDLQLGLSLLSLLGLVVGVPVGLCYNALLVLANLHSKASMT
MPDVYFVNMAVAGLVLSALAPVHLLGPPSSRWALWSVGGEVHVALQIPFNVSSLVAMYST
ALLSLDHYIERALPRTYMASVYNTRHVCGFVWGGALLTSFSSLLFYICSHVSTRALECAK
MQNAEAADATLVFIGYVVPALATLYALVLLSRVRREDTPLDRDTGRLEPSAHRLLVATVC
TQFGLWTPHYLILLGHTVIISRGKPVDAHYLGLLHFVKDFSKLLAFSSSFVTPLLYRYMN
QSFPSKLQRLMKKLPCGDRHCSPDHMGVQQVLA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctgcagctggttcaacggcacagggctggtggaggagctgcctgcctgccag
gacctgcagctggggctgtcactgttgtcgctgctgggcctggtggtgggcgtgccagtg
ggcctgtgctacaacgccctgctggtgctggccaacctacacagcaaggccagcatgacc
atgccggacgtgtactttgtcaacatggcagtggcaggcctggtgctcagcgccctggcc
cctgtgcacctgctcggccccccgagctcccggtgggcgctgtggagtgtgggcggcgaa
gtccacgtggcactgcagatccccttcaatgtgtcctcactggtggccatgtactccacc
gccctgctgagcctcgaccactacatcgagcgtgcactgccgcggacctacatggccagc
gtgtacaacacgcggcacgtgtgcggcttcgtgtggggtggcgcgctgctgaccagcttc
tcctcgctgctcttctacatctgcagccatgtgtccacccgcgcgctagagtgcgccaag
atgcagaacgcagaagctgccgacgccacgctggtgttcatcggctacgtggtgccagca
ctggccaccctctacgcgctggtgctactctcccgcgtccgcagggaggacacgcccctg
gaccgggacacgggccggctggagccctcggcacacaggctgctggtggccaccgtgtgc
acgcagtttgggctctggacgccacactatctgatcctgctggggcacacggtcatcatc
tcgcgagggaagcccgtggacgcacactacctggggctactgcactttgtgaaggatttc
tccaaactcctggccttctccagcagctttgtgacaccacttctctaccgctacatgaac
cagagcttccccagcaagctccaacggctgatgaaaaagctgccctgcggggaccggcac
tgctccccggaccacatgggggtgcagcaggtgctggcgtag

DBGET integrated database retrieval system