KEGG   Homo sapiens (human): 116Help
Entry
116               CDS       T01001                                 

Gene name
ADCYAP1, PACAP
Definition
(RefSeq) adenylate cyclase activating polypeptide 1
  KO
K05262  pituitary adenylate cyclase-activating polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04911  Insulin secretion
hsa04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    116 (ADCYAP1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116 (ADCYAP1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    116 (ADCYAP1)
   04924 Renin secretion
    116 (ADCYAP1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    116 (ADCYAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_2
Motif
Other DBs
NCBI-GeneID: 116
NCBI-ProteinID: NP_001093203
OMIM: 102980
HGNC: 241
Ensembl: ENSG00000141433
Vega: OTTHUMG00000131479
Pharos: P18509(Tbio)
CPD: C16088 C16089
UniProt: P18509
LinkDB All DBs
Structure
PDB: 

Position
18p11.32
AA seq 176 aa AA seqDB search
MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtgtagcggagcgaggctggccctgctggtctatgggataatcatgcacagc
agcgtctacagctcacctgccgccgccggactccggttccccgggatcaggccagaggaa
gaggcgtacggcgaggacggaaacccgctgccagacttcgatggctcggagccgccgggc
gcagggagccccgcctccgcgccgcgcgccgccgccgcctggtaccgcccggccgggaga
agagatgtcgcccacgggatccttaacgaggcctaccgcaaagtgctggaccagctgtcc
gccgggaagcacctgcagtcgctcgtggcccggggcgtgggtgggagcctcggcggcggc
gcgggggacgacgcggagccgctctccaagcgccactcggacgggatcttcacggacagc
tacagccgctaccggaaacaaatggctgtcaagaaatacttggcggccgtcctagggaag
aggtataaacaaagggttaaaaacaaaggacgccgaatagcttatttgtag

DBGET integrated database retrieval system