KEGG   Homo sapiens (human): 1164Help
Entry
1164              CDS       T01001                                 

Gene name
CKS2, CKSHS2
Definition
(RefSeq) CDC28 protein kinase regulatory subunit 2
  KO
K02219  cyclin-dependent kinase regulatory subunit CKS1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1164 (CKS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    1164 (CKS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CKS Peptidase_M29
Motif
Other DBs
NCBI-GeneID: 1164
NCBI-ProteinID: NP_001818
OMIM: 116901
HGNC: 2000
Ensembl: ENSG00000123975
Vega: OTTHUMG00000020180
Pharos: P33552(Tbio)
UniProt: P33552
LinkDB All DBs
Structure
PDB: 

Position
9q22.2
AA seq 79 aa AA seqDB search
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH
EPEPHILLFRRPLPKDQQK
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcccacaagcagatctactactcggacaagtacttcgacgaacactacgagtaccgg
catgttatgttacccagagaactttccaaacaagtacctaaaactcatctgatgtctgaa
gaggagtggaggagacttggtgtccaacagagtctaggctgggttcattacatgattcat
gagccagaaccacatattcttctctttagacgacctcttccaaaagatcaacaaaaatga

DBGET integrated database retrieval system