KEGG   Homo sapiens (human): 116442
Entry
116442            CDS       T01001                                 

Gene name
RAB39B, BGMR, MRX72, WSMN, WSN
Definition
(RefSeq) RAB39B, member RAS oncogene family
  KO
K07925  Ras-related protein Rab-39B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    116442 (RAB39B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    116442 (RAB39B)
   05022 Pathways of neurodegeneration - multiple diseases
    116442 (RAB39B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116442 (RAB39B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    116442 (RAB39B)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Rab GTPases
    116442 (RAB39B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab39/42 [OT]
    116442 (RAB39B)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU CENP-M AAA_22 TniB
Other DBs
NCBI-GeneID: 116442
NCBI-ProteinID: NP_741995
OMIM: 300774 311510
HGNC: 16499
Ensembl: ENSG00000155961
Vega: OTTHUMG00000022659
Pharos: Q96DA2(Tbio)
UniProt: Q96DA2
LinkDB
Position
Xq28
AA seq 213 aa
MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKL
QIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVL
VGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEI
TIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC
NT seq 642 nt   +upstreamnt  +downstreamnt
atggaggccatctggctgtaccagttccggctcattgtcatcggggattccacagtgggc
aagtcctgcctgatccgccgcttcaccgagggtcgctttgcccaggtttctgaccccacc
gtgggggtggattttttctcccgcttggtggagatcgagccaggaaaacgcatcaagctc
cagatctgggataccgcgggtcaagagaggttcagatccatcactcgcgcctactacagg
aactcagtaggtggtcttctcttatttgacattaccaaccgcaggtccttccagaatgtc
catgagtggttagaagagaccaaagtacacgttcagccctaccaaattgtatttgttctg
gtgggtcacaagtgtgacctggatacacagaggcaagtgactcgccacgaggccgagaaa
ctggctgctgcatacggcatgaagtacattgaaacgtcagcccgagatgccattaatgtg
gagaaagccttcacagacctgacaagagacatatatgagctggttaaaaggggggagatt
acaatccaggagggctgggaaggggtgaagagtggatttgtaccaaatgtggttcactct
tcagaagaggttgtcaaatcagagaggagatgtttgtgctag

KEGG   Homo sapiens (human): 4218
Entry
4218              CDS       T01001                                 

Gene name
RAB8A, MEL, RAB8
Definition
(RefSeq) RAB8A, member RAS oncogene family
  KO
K07901  Ras-related protein Rab-8A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04152  AMPK signaling pathway
hsa04530  Tight junction
hsa04972  Pancreatic secretion
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    4218 (RAB8A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4218 (RAB8A)
   04140 Autophagy - animal
    4218 (RAB8A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4218 (RAB8A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    4218 (RAB8A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    4218 (RAB8A)
   05022 Pathways of neurodegeneration - multiple diseases
    4218 (RAB8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4218 (RAB8A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    4218 (RAB8A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4218 (RAB8A)
   04031 GTP-binding proteins [BR:hsa04031]
    4218 (RAB8A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    4218 (RAB8A)
 Autophagy
  Other autophagy associated proteins
    4218 (RAB8A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    4218 (RAB8A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4218 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   4218 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   4218 (RAB8A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    4218 (RAB8A)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 Phage_holin_6_1 AAA_16
Other DBs
NCBI-GeneID: 4218
NCBI-ProteinID: NP_005361
OMIM: 165040
HGNC: 7007
Ensembl: ENSG00000167461
Vega: OTTHUMG00000182238
Pharos: P61006(Tbio)
UniProt: P61006 A0A024R7I3
LinkDB
Structure
PDB: 

Position
19p13.11
AA seq 207 aa
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITPDQQKRSSFFRCVLL
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacttttatctccacc
ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactgcag
atatgggacacagccggtcaggaacggtttcggacgatcacaacggcctactacaggggt
gcaatgggcatcatgctggtctacgacatcaccaacgagaagtccttcgacaacatccgg
aactggattcgcaacattgaggagcacgcctctgcagacgtcgaaaagatgatactcggg
aacaagtgtgatgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc
ctcgactatggaatcaagttcatggagaccagcgcgaaggccaacatcaatgtggaaaat
gcatttttcactctcgccagagatatcaaagcaaaaatggacaaaaaattggaaggcaac
agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc
tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system