KEGG   Homo sapiens (human): 116983Help
Entry
116983            CDS       T01001                                 

Gene name
ACAP3, CENTB5
Definition
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116983 (ACAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116983 (ACAP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    116983 (ACAP3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    116983 (ACAP3)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    116983 (ACAP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116983 (ACAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 ArfGap PH Ank_5 Ank_2 Ank_3 Ank_4 Ank PH_11 BAR Exonuc_VII_L PH_8
Motif
Other DBs
NCBI-GeneID: 116983
NCBI-ProteinID: NP_085152
HGNC: 16754
Ensembl: ENSG00000131584
Vega: OTTHUMG00000002235
Pharos: Q96P50(Tdark)
UniProt: Q96P50 Q8WTZ1
LinkDB All DBs
Position
1p36.33
AA seq 834 aa AA seqDB search
MTVEFEECVKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMVEAGKAYVSTSRLFVSG
VRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKEDVRKFKE
TKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQA
KKKFEILDSMLSFMHAQSSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKH
AAIQQRTLLQDFSYDESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVY
QKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVLSPTKSCMLQADSEKLRQAWVQAVQA
SIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVLQRVQSVAGNSQCGD
CGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSAVN
QIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRVQKCLR
PHSSPRAPTARRKVRLEPVLPCVAALSSVGTLDRKFRRDSLFCPDELDSLFSYFDAGAAG
AGPRSLSSDSGLGGSSDGSSDVLAFGSGSVVDSVTEEEGAESEESSGEADGDTEAEAWGL
ADVRELHPGLLAHRAARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIVCE
FLLQNGADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQRDPLAIAVQAA
NADIVTLLRLARMAEEMREAEAAPGPPGALAGSPTELQFRRCIQEFISLHLEES
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagttcgaggagtgcgtcaaggactccccgcgcttcagggcgaccattgac
gaggtggagacggacgtggtggagattgaggccaaactggacaagctggtgaagctgtgc
agtggcatggtggaagccggtaaggcctacgtcagcaccagcaggcttttcgtgagcggc
gtccgcgacctgtcccagcagtgccagggcgacaccgtcatctcggaatgtctgcagagg
ttcgctgacagcctacaggaggtggtgaactaccacatgatcctgtttgaccaggcccag
aggtccgtgcggcagcagctccagagctttgtcaaagaggatgtgcggaagttcaaggag
acaaagaagcagtttgacaaggtgcgggaggacctggagctgtccctggtgaggaacgcc
caggccccgaggcaccggccccacgaggtggaggaagccaccggggccctcaccctcacc
aggaagtgcttccgccacctggcactggactatgtgctccagatcaatgttctgcaggcc
aagaagaagtttgagatcctggactctatgctgtccttcatgcacgcccagtccagcttc
ttccagcagggctacagcctcctgcaccagctggacccctacatgaagaagctggcagcc
gagctggaccagctggtgatcgactctgcggtggaaaagcgtgagatggagcgaaagcac
gccgccatccagcagcggacgctgctgcaggacttctcctacgatgagtccaaagtggag
tttgacgtggacgcgcccagtggggtggtgatggagggctacctcttcaagagggccagc
aacgctttcaagacatggaaccggcgctggttctccattcagaacagccagctggtctac
cagaagaagctcaaggatgccctcaccgtggtggtggatgacctccgcctgtgctctgtg
aagccgtgtgaggacatcgagcggaggttctgcttcgaggtgctgtcacccaccaagagc
tgcatgctgcaggctgactccgagaagctgcggcaagcctgggtccaggctgtgcaggcc
agcatcgcctccgcctaccgcgagagccctgacagttgctatagcgagaggctggaccgc
acagcatccccgtccacgagcagcatcgactccgccaccgacactcgggagcgtggcgtg
aagggcgagagtgtgctgcagcgtgtgcagagtgtggccggcaacagccagtgcggcgac
tgcggccagccggacccccgctgggccagcatcaacctgggcgtgctgctctgcattgag
tgctccggcatccacaggagcctgggtgtccactgctccaaggtgcggtccctgacgctg
gactcgtgggagcctgagctgctaaagctgatgtgtgagcttggaaacagcgctgtgaat
cagatctatgaggcccagtgtgagggtgcaggcagcaggaaacccacagccagcagctcc
cggcaggacaaggaggcctggatcaaggacaaatacgtggaaaagaagtttctgcggaag
gcgcccatggcaccagccctggaggccccaagacgctggagggtgcagaagtgcctgcgg
ccccacagctctccccgcgctcccactgcccgccgcaaggtccggcttgagcccgttctg
ccctgtgtggccgctctgtcctcagtgggcaccctggatcgtaagttccgccgagactcc
ctcttctgtcccgacgagctggactcgctcttctcctacttcgacgcaggggccgcaggg
gctggccctcgcagtctgagtagcgacagtggccttgggggcagctcggatggcagctcg
gacgtcctggctttcggctcgggctctgtggtggacagcgtcactgaggaggagggtgca
gagtcggaggagtccagcggtgaggcagacggggacactgaggccgaggcctggggcctg
gcggacgtgcgcgagctgcacccggggctcttggcgcaccgcgcagcgcgtgcccgcgac
cttcctgcgctggcggcggcgctggcccacggggccgaggtcaactgggcggacgcggag
gatgagggcaagacgccgctggtgcaggccgtgctagggggctccttgatcgtctgtgag
ttcctgctgcaaaacggagcggacgtgaaccaaagagacagccggggccgggcgcccctg
caccacgccacgctgctgggccgcaccggccaggtttgcctgttcctgaagcggggcgcg
gaccagcacgccctggaccaagagcagcgggacccgttggccatcgcagtgcaggcggcc
aacgctgacatcgtgacactgctccgtctggcgcgcatggcggaggaaatgcgcgaggcc
gaggctgcccctggtcccccgggcgccctggcgggcagccccacggagctccagttccgc
aggtgtatccaggagttcatcagcctccacctggaagagagctag

KEGG   Homo sapiens (human): 116984Help
Entry
116984            CDS       T01001                                 

Gene name
ARAP2, CENTD1, PARX
Definition
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2
  KO
K18440  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116984 (ARAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116984 (ARAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    116984 (ARAP2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    116984 (ARAP2)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    116984 (ARAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH RhoGAP ArfGap SAM_1 PH_6 SAM_2 PH_3 PH_11 RA DNA_pol_phi PH_8 Mcp5_PH
Motif
Other DBs
NCBI-GeneID: 116984
NCBI-ProteinID: NP_056045
OMIM: 606645
HGNC: 16924
Ensembl: ENSG00000047365
Vega: OTTHUMG00000097811
Pharos: Q8WZ64(Tbio)
UniProt: Q8WZ64 A7E2A5
LinkDB All DBs
Structure
PDB: 

Position
4p14
AA seq 1704 aa AA seqDB search
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQL
ETVRKNLEDSDASVERSQYPQSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIES
LITKKTVDHTVEEQQTEKVKLITENLSKLPNADSECLSFVGCSTSGTNSGNGTNGLLEGS
PPSPFFKFQGEMIVNDLYVPSSPILAPVRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGVS
GSYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQGE
ALKGEAATATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEE
CFQSLRRKNSKASKSRTQKALILDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGAS
AKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFT
AETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMD
SPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLY
QAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKED
FYLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQ
LFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDAL
LTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDT
QVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVI
ENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKRFLTADTIKHCSDRSTLGSIKEGI
LKIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHDKMFSLSSMKFYRGVKKKMKP
PTSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHEYDIWPPAGKERKRSITKNPKIG
GLPLIPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDSSLKERASMVAHCLEHKD
DKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVI
EELNVVLQRSRTLPKELQDEQILK
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagtcagtgaagtaaatgtggatataaaagatttcctaatgagcattaatttg
gagcagtatctcttacatttccatgagtctggttttactactgtgaaggactgtgcagca
ataaatgacagcctgctgcagaaaattggaatatcacctacaggtcaccgtaggaggata
cttaaacagttacagataatcttgtcaaaaatgcaagatattccaatatatgcaaatgtt
cataaaactaagaagaatgatgacccttcaaaggattaccatgttccatcttctgatcag
aatatctgcatagaactttccaattctggtagtgttcagacatctagcccaccgcagttg
gagactgttagaaaaaatcttgaagacagtgatgcaagtgtggaaagaagccagtatcct
caatcagatgataagctgtctcctcctaaacgcgacttccccactgcagaggaaccacac
ctgaatttgggttctttgaatgattctttatttggtagtgacaatattaaaatagaatca
ttgattacaaagaagactgtggatcacacagttgaagaacaacaaacagaaaaagttaaa
ttgatcacagaaaatctcagtaagctccctaatgcagactctgaatgcctttcttttgtt
ggctgttcaacatcaggaacaaattctggaaatggaacaaatggtttattagaaggatca
ccaccatccccattctttaagtttcaaggagaaatgattgtaaatgacttgtatgttcca
tcatcaccaatcctagcacctgtgagaagtcgtagcaagttggtttcaagaccatctcga
tcttttctgctaagacatcgacctgtaccagagattccagggtcaacaaaaggagtttct
gggagctatttccgtgaaagaagaaatgttgctacctcaactgaaaaatctgtggcatgg
caaaattcaaatgaggagaattcatcttccatctttccttatggagagacctttctcttc
cagagactagaaaattccaagaagcgatctataaagaatgaatttttgacccagggagaa
gcactcaaaggggaagcagctactgcaacaaactcttttatcatcaaatcaagcatatac
gataacagaaaggagaaaataagcgaggacaaggtggaagatatttggatacctcgagag
gacaaaaacaattttttgatagacactgcttctgaatcagaatactcaacagtagaagaa
tgctttcagagtttaagaagaaaaaattcaaaggcatctaaatctaggactcaaaaagcc
ttgattttggactccgttaataggcacagttatccgttaagctcaacaagtggaaatgct
gattcatcagccgtttcttcacaggcaatatctccctatgcctgcttttatggagcatct
gcaaagaaggttaaatcaggatggctggataaactctctcctcaaggaaaacgcatgttt
caaaagagatgggtgaaatttgatggccttagcatttcttactacaataatgagaaggag
atgtattcgaaaggaataattcccctttctgctatatcaacagtacgagttcaaggagac
aacaaatttgaagttgttacaacacaaagaacttttgtttttagagtagaaaaagaagag
gagagaaatgactggatcagcatactattaaatgcactgaaatcacaatcccttacctcg
cagtctcaagctgttgttacacctgagaaatgtggatatcttgaattgagaggctataag
gcaaaaatttttactgtgttaagtggaaacagtgtgtggctttgcaaaaacgaacaggat
tttaagagtggacttggtattaccataattcctatgaatgtagcaaatgtaaagcaagtg
gaccgaactgtgaaacaatcttttgaaataatcactccctacaggagtttcagctttaca
gccgagactgaaaaggagaaacaagactggattgaagctgtgcagcaatcaatagcagaa
actctctctgattatgaagtagctgagaagatttggttcaatgaatccaacaggagctgt
gcagattgtaaagccccagatcctgactgggcatccatcaatctctgtgttgtcatctgt
aagaagtgtgcaggacagcatagatctttaggaccaaaagattccaaggttagaagtcta
aaaatggatgctagcatttggagcaatgaactcatcgagctttttattgtcattggaaac
aaaagagcaaatgacttttgggctggtaatcttcaaaaggatgaagaattacatatggac
tcaccagtagaaaagagaaaaaactttattactcagaaatataaagaaggaaaattcaga
aaaactcttttggcatctctcaccaaagaagaattaaataaggctctatgtgctgctgta
gtgaaaccggatgttctagaaacaatggctttgctgttcagtggagcagatgtcatgtgt
gccaccggagaccccgtgcatagcaccccctatctgctagccaagaaagctgggcaaagt
ctgcaaatggaatttctctaccataacaaattctcagatttccctcaacatgatattcat
tccgagggtgtattaagtcaagagtcttcccagtccacattcctctgtgactttttatat
caagctccttctgctgcttctaaactctcttcagagaaaaaactgcttgaagagacaaat
aaaaaatggtgtgttttggaaggaggcttcttgagttactatgaaaatgataagtctacc
acacctaatggcaccattaatatcaatgaagttatctgcctggctatacacaaagaggac
ttctatttaaatactgggcccatctttatctttgagatctacttaccctccgaacgtgtg
tttttatttggagctgaaacatctcaagctcaaagaaaatggacagaggcaatagccaag
cattttgttcccttatttgctgaaaacttaacagaagctgactatgatttgattggtcaa
ctcttctacaaagactgccatgccctggatcagtggagaaaaggctggtttgctatggac
aaatccagcttgcatttttgccttcaaatgcaagaagttcagggagatagaatgcactta
agaagactgcaagagctaacaatcagcacaatggttcaaaatggggaaaaactggatgtt
ttactcttggtagaaaaagggagaacattatacatccatgggcataccaagttggatttc
acagtctggcatactgcaattgaaaaagcagcaggtacagatggtaatgctttacaagat
cagcagctcagcaaaaatgacgttcccattatagtgaacagctgtatagcatttgttaca
cagtatggtttaggatgcaaatatatctatcaaaagaatggtgatcctttgcatataagt
gaactcctggagagtttcaaaaaggatgcaagaagctttaaattgagggctggaaaacat
cagcttgaagatgtgacggctgtgttgaaaagttttctctctgacattgatgatgcactg
cttactaaggagctctacccatattggatctctgctttagatacgcaagatgacaaggaa
agaattaaaaaatatggagcatttatacgttctcttccaggggtcaaccgagcaacacta
gcagctatcattgaacacctgtatagggttcagaaatgctcagaaatcaatcacatgaat
gcccataatttggccttggtcttttcatcctgtttgtttcaaacgaagggacaaactagt
gaagaagtgaatgtaattgaggacctaattaataattatgtagaaatatttgaggttaaa
gaagatcaagtcaaacaaatggacatagaaaatagctttattaccaagtggaaagacacc
caagtttcccaggctggagatttgttaattgaagtatatgtagaaaggaaggaacccgac
tgtagtattataattcggatatctcctgtgatggaagcagaagaattaactaatgatata
ttagcgataaaaaatattattcctacaaaaggtgatatttgggccacatttgaagtcatt
gaaaatgaagagctagagcgtcctcttcactacaaggaaaatgtactggagcaggtgctt
cggtggagttcattagctgaacctggctctgcttacctggtggtgaagagattcttaacc
gctgacacaattaaacactgcagtgaccggagtacactgggaagcatcaaagaaggaatc
ttgaaaatcaaagaagaaccatccaaaatactatctggaaataagtttcaagaccggtat
tttgttttacgagatgggtttctctttctttacaaggatgtgaagagtagtaaacatgac
aagatgttttctctcagttccatgaagttttatcgtggagtgaaaaagaaaatgaagcct
ccaacaagctggggattgaccgcatattctgagaaacatcactggcacctgtgttgtgat
agttcacgaactcagacggagtggatgaccagtatctttattgcccagcatgaatatgat
atatggccaccagctggaaaggaacgaaaacgttcaataaccaaaaatcccaaaattgga
ggtttgcctctgattcctatacagcatgaggggaatgcaaccttggcccggaaaaatatt
gagagtgcaagagcagaacttgaaaggctgcggctcagtgaaaagtgtgataaagagtcc
gtggactctagcttaaaggagagagcttccatggtggcccactgcctggagcacaaggac
gataaacttcgaaatcgaccccgaaaacatcggagtttcaactgcctggaggacacagag
cctgaagccccacttgggcaaccaaaaggccataaaggcctaaagacattgaggaagact
gaggacaggaatagcaaagctactttggactctgatcataagttaccatcaagggtaatt
gaagaacttaatgtggttctacaacggtcaagaacccttccaaaagaattacaggatgag
cagattttgaagtag

KEGG   Homo sapiens (human): 116985Help
Entry
116985            CDS       T01001                                 

Gene name
ARAP1, CENTD2
Definition
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
  KO
K18439  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116985 (ARAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116985 (ARAP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    116985 (ARAP1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    116985 (ARAP1)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    116985 (ARAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH RhoGAP ArfGap RA PH_11 SAM_1 SAM_2 PH_8 PH_6 PH_13 PH_9 Thioredoxin_6
Motif
Other DBs
NCBI-GeneID: 116985
NCBI-ProteinID: NP_001035207
OMIM: 606646
HGNC: 16925
Ensembl: ENSG00000186635
Vega: OTTHUMG00000157102
Pharos: Q96P48(Tbio)
UniProt: Q96P48
LinkDB All DBs
Position
11q13.4
AA seq 1450 aa AA seqDB search
MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRI
LAGLLRAHTSPAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPR
RSCLPPTCFTTPSTAAPDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLVSLPTKEEESLL
PSLSSPPQPQSEEPLSTLPQGPPQPPSPPPCPPEIPPKPVRLFPEFDDSDYDEVPEEGPG
APARVMTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSS
LSLSLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYF
DSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAE
QRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGI
TFIDMSVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAER
IWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET
LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQE
ELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNR
TTEVPRLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGV
LSYFENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHE
WVKCIAKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPC
EEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL
SEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEG
EQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRA
TVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS
VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAE
ELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQ
AMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQ
RPWSGAPETSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDT
QMELREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFT
ADPLSLLRNV
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctggggatgctgcgctatcggtggccgagtggctgcgggcattgcacctg
gagcagtacacggggctctttgagcagcatggcctggtgtgggccactgagtgccaaggc
ctcagcgacacccgcctgatggacatgggcatgctactccctggtcaccgccgccgcatc
ctggctggcctgctccgtgcccatacctcaccggcccctgcaccccgccccaccccacgg
cctgtgcccatgaagcgccacatcttccgctcaccacctgtgcctgccactccacccgag
ccgctgcccaccactacagaggatgaggggctccccgctgccccacccatcccgccccgg
aggagctgccttccgcccacctgcttcaccaccccatccacagctgccccagaccctgtg
ctgcccccgctgcctgctaagcggcatttggcagagctgagcgttccacccgtgccgccc
cgcaccggacccccccgcctgctggtgagcctgcccactaaggaggaggagtcattgctg
ccatcattatcatcccctccccagccacagtctgaggagcccctgtccaccctcccccag
gggcctccccagcctccctctccacctccctgccccccggagatacctccaaagccggta
cgcctgttcccagagttcgatgactctgactacgatgaggtcccagaggaggggccgggg
gccccagccagagtgatgaccaagaaggaggagcccccaccgagccgagtcccacgggcc
gtgcgcgtggccagtctgctgagcgagggagaggaactgtctggggacgaccaaggggat
gaggaagaggatgaccacgcctatgagggcgtccccaatggcggatggcataccagcagc
ctgagcttgtccttgcccagcacaatagctgcgccacaccccatggacgggccgcctggg
ggctccacccccgtcacaccagtcatcaaggctggctggctggacaagaacccaccgcag
ggatcttacatctatcagaaacgatgggtgagactggatactgatcacctgcgatacttt
gacagtaacaaggacgcttactctaagcgctttatctctgtggcctgcatctcccacgtg
gctgccatcggggaccagaagtttgaagtgatcacaaacaaccgaacctttgccttccgg
gcagagagtgatgtggagcggaaggagtggatgcaggccctgcagcaggccatggctgag
cagcgtgcccgggcccggctctctagcgcttatctgctgggagttccaggctcagagcag
cctgaccgcgctggcagcctggagcttcgtggcttcaagaataagctgtacgtggccgtg
gtcggggacaaagtgcagctctacaagaatctagaggagtaccacctgggcattggcatc
accttcatcgacatgagcgtgggcaacgtgaaggaagtggaccggcgcagcttcgacctc
accacgccctaccgcatcttcagcttctctgctgactcagagctagagaaggagcagtgg
ttggaggccatgcagggagccatcgctgaggccctgtctacctcggaggtggccgagcgc
atctgggctgcagcccccaacaggttctgtgctgactgcggggctcctcagcctgactgg
gcctccatcaacctctgtgttgttatctgcaagcgctgtgcaggggagcaccgtggcctg
ggcgctggcgtctccaaggtgcggagcctgaagatggacaggaaggtgtggacagaaaca
cttatcgagctcttcttacagctggggaatggcgctgggaaccgcttctgggcagccaac
gtgccccccagtgaggccctgcagcccagcagcagccccagcacccggcggtgccacctg
gaggccaagtaccgtgagggcaagtaccgccgctaccacccgctctttggcaaccaggag
gagctggacaaggccctgtgtgctgcagtcaccaccacagacctggctgagacccaggcg
ctcctgggctgtggggctgggatcaactgcttctcgggggaccctgaggcccccacgccc
ctggctcttgcagagcaggcggggcagacgctgcagatggaattccttcggaacaaccgg
accacagaggtgcctcggctggactcgatgaagcccctggaaaagcactactcagttgtc
ctgccgaccgtgagccacagtggcttcctctacaagactgcctctgccggcaagctgcta
caggaccgccgggcccgggaagagttcagccggcgctggtgtgtccttggtgacggggtc
ctgagctactttgagaatgagcgggcagtgacccccaatggagagattcgggccagcgag
attgtgtgcctggcagtgccccctcctgacacccatggctttgagcacacctttgaggtg
tacacggagggagaacggctgtacctgtttgggctggagagtgcggagcaggctcatgag
tgggtcaagtgtattgctaaggcattcgtgcctcccctagccgaggatctgctggcccgg
gattttgagcggctgggacgcctaccctacaaagctggcctgagcctacagcgggcccag
gagggctggttctctctcagtggctcggagctccgtgctgtcttcccggaggggccctgc
gaagagccgctgcaactacggaaactgcaggagctttccatccagggggacagtgagaac
caggtgctggtgctggtggagcgaaggaggacactgtacatacagggcgagcggcggctg
gacttcatgggttggctgggggccatccagaaagcagccgccagcatgggggacacgctg
tcggagcagcagcttggggactcggatatcccggtgatcgtgtaccgctgtgtggactac
atcacgcagtgcggcctgacctccgagggcatctaccgcaagtgtgggcagacatcgaag
acacagcggctgctggagagcctgcggcaggatgcgcgctctgtgcacctcaaggagggc
gagcagcacgtggatgatgtttcctcggcgctcaagcgcttcctgcgcgacctgcctgat
gggctcttcactcgcgcccagcgcctaacctggctggaggcctcagagattgaggacgag
gaggagaaggtctccaggtaccgagagctgctggtgcggctgccccctgtcaaccgggcc
acagtgaaggcccttatcagccacctgtactgtgttcagtgcttctcagacacgaaccag
atgaacgtgcacaacctggcaattgtgtttgggcccacgctcttccagacagatgggcag
gactacaaggctggccgtgtggtggaagacctcattaaccactatgtggtggtgtttagt
gtggatgaggaagagctcaggaagcagcgggaggagatcactgccattgtgaagatgcgc
gtggctggcactgccagtgggacccagcatgccggtgacttcatctgcacagtgtatctg
gaagagaagaaggcagagactgagcagcatatcaaggtcccagcatccatgactgctgag
gagctcaccctggagatcctggatcgccggaacgtgggcatcagggagaaggactattgg
acctgctttgaggtcaacgagagggaggaggcagagcgccccctgcactttgcggagaag
gtgctgcccatcctgcacgggctgggcacggacagccacctggtggtgaagaagcaccag
gccatggaggccatgctgctgtacctggccagccgtgtcggtgacaccaagcatggcatg
atgaagttccgtgaggaccgcagcctcctgggcctgggcctgccctcaggtggcttccac
gatcgctacttcatcctcaacagcagctgcttgcggctctacaaggaggtccggagccag
aggccgtggagcggggcccctgagaccagtcaccggcctgagaaggagtggcctattaag
agtctcaaagtctacctgggagtgaagaagaaactcaggccacccacctgctggggcttc
acagtggtgcatgagacagagaaacatgagaagcagcagtggtacctctgctgtgacaca
cagatggagctccgggagtggttcgctacctttctgtttgtgcagcatgacggcctggtg
tggccctcagagccctcacgcgtgtcccgggcagtgcctgaggtccggctgggtagtgtg
tcactgatcccccttcgaggtagtgaaaatgaaatgcgccggagtgtggctgccttcacc
gcggaccctctgtctcttctgcgcaacgtctga

KEGG   Homo sapiens (human): 116986Help
Entry
116986            CDS       T01001                                 

Gene name
AGAP2, CENTG1, GGAP2, PIKE
Definition
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
  KO
K17848  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    116986 (AGAP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116986 (AGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116986 (AGAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    116986 (AGAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap Ras PH Ank_2 Ank Ank_5 Ank_4 PH_6 Roc Ank_3 Spore_IV_A
Motif
Other DBs
NCBI-GeneID: 116986
NCBI-ProteinID: NP_001116244
OMIM: 605476
HGNC: 16921
Ensembl: ENSG00000135439
Vega: OTTHUMG00000170285
Pharos: Q99490(Tbio)
UniProt: Q99490 F8VVT9
LinkDB All DBs
Structure
PDB: 

Position
12q14.1
AA seq 1192 aa AA seqDB search
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAAGAAGARGSETGDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGTGGAEPPALSPAPASPARPVSPAPGRRLSLWAVPPG
PPLSGGLSPDPKPGGAPTSSRRPLLSSPSWGGPEPEGRAGGGIPGSSSPHPGTGSRRLKV
APPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATA
AAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPS
PATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPP
GSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFS
LEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMK
RCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEK
RSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHS
THGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSP
SPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDA
WVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLN
LGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAK
PSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHG
PLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCA
DILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgagccggggcgcgggcgcgcttcagcgccggacaacgacctacctcatctcgctgacc
ctggttaagctcgagtcggtgcctccgccgccgccttctccgtctgcggccgcggccggc
gccgccggtgccagaggctccgagactggggatcctggcagcccccgaggcgcggaggag
ccgggcaagaagcggcacgaacgtctcttccaccggcaggatgcgctgtggatcagcacg
agcagcgcgggcaccgggggcgcggagcccccagccctgtccccggctccggccagtccg
gcccgcccagtctcccccgctcccggccgccgcctctccctctgggccgtccctccggga
cccccgctctccgggggactgagccccgaccccaagcctgggggcgcccccacctcctcc
cggcgccccctgctcagcagcccgagctggggcggcccggagcccgaaggccgggcgggc
ggcggcatccctggctcatcctctccgcaccctggcaccggcagccggaggctcaaggtg
gcgcctcctccgccggctcccaagccttgcaagaccgtgaccacgagtggagccaaagcc
ggcgggggcaagggcgcgggtagccgcctgtcatggcccgaaagcgagggcaagcccagg
gtcaaggggtcaaagagcagcgccgggactggagcttcggtctctgccgccgccaccgcc
gccgccgccgggggagggggctctacagcttcgacctctggtggggtcggggctggggct
ggagcccgagggaagttgtcccctcggaaaggcaagagtaagaccttggacaacagtgac
ttgcatccgggaccgcctgccggctctcctcctccgctaaccctcccaccaactccgagt
ccagccactgctgtcaccgctgcttccgcgcagccccccgggcctgcacctccaatcact
ctggagcctccagctccggggctgaaacggggccgggaggggggccgagcatccactcgt
gaccgcaagatgctcaagtttatcagcggcatcttcaccaagagcacaggagggcctcct
ggctccgggccccttcccggaccccccagcctgtcttctggcagcgggtccagggagctg
ctgggcgccgagctccgcgcttcccctaaggctgtgatcaatagccaggaatggactttg
agccgctccattcctgaactgcgcctgggtgtgctgggcgatgccaggagtgggaagtca
tcgctcatccaccgattcctgactggctcataccaggtgctggagaagacagagagtgag
cagtacaagaaagaaatgttggtggatggacagacacatctggtgctaatccgagaggaa
gctggggcacctgatgccaagttctcaggctgggcagatgctgtgatcttcgtcttcagc
ctggaggatgagaacagtttccaggctgtgagccgtctccatgggcagctgagttccctt
cgcggggagggacgaggaggcctggccttggcactggtggggacacaagacaggatcagt
gcttcctcccctcgggtggtgggagatgctcgtgccagagctctgtgcgcggacatgaaa
cgctgcagctactatgagacttgtgcaacctatgggctcaatgtggatcgggtcttccag
gaggtggcccagaaggtggtgaccttgcgcaagcagcaacagcttctggctgcctgcaag
tccctgcccagctccccaagccactcagctgcatccactccggtagctggccaggctagt
aacgggggccacactagcgactactcttcttccctcccgtcctcaccgaatgttggtcac
cgggagctccgagccgaggcagctgcagtggctggattgagcaccccagggtccctgcac
cgggcagccaagcgcaggaccagcctttttgcgaatcgtcggggtagtgactccgagaaa
cgaagcttggatagtcggggagagacaacagggagtgggcgagccatccccatcaaacag
agcttcctactaaaacgaagtggcaattccttgaacaaagaatggaagaagaaatatgta
accctgtccagtaatggctttctactctaccaccccagtattaacgattacatccacagt
acccacggcaaggagatggacttgctgcgaacaacagtcaaagtcccgggcaagcggccc
ccgagggccatctctgcctttggcccctcagccagcattaacgggctcgtcaaggacatg
agcactgtccagatgggtgaaggcctggaagccactactcccatgccaagccctagcccc
agccccagttccctgcagccaccaccagatcagacatccaaacacctgctgaagccagac
cggaatttggcccgagccctcagcacggactgtaccccatctggagacctgagccccctg
agtcgggaaccccctccttctcccatggtgaagaagcagaggaggaaaaaattgacaaca
ccatccaagactgaaggctcggctgggcaggctgaagccaagcgcaaaatgtggaaacta
aaatcctttggtagtttaagaaatatttataaagcagaggaaaactttgagttcctgatc
gtgtccagcacgggtcagacgtggcactttgaggcagccagttttgaggagcgggatgcc
tgggtccaggccatcgagagtcagatcctagccagtctgcaatgctgtgagagcagcaag
gtcaagctgcgcacagacagccaaagcgaggccgtggccatccaggcgatccggaacgcc
aaggggaattcaatctgcgtggactgcggggcccccaaccccacgtgggccagcttgaac
ctgggcgccctcatctgcatcgagtgttctggcatccaccgcaacctgggcacacacctg
tcccgcgttcgctcgctggacttggacgactggccacgggagctgaccctggtgctgacg
gctattggcaacgacacggccaaccgcgtgtgggaaagcgacacgcgaggccgtgccaag
ccctcgcgggactcttcgcgggaggagcgcgagtcgtggattcgcgccaagtacgagcag
ctactgttcctggcgccgctgagcacctcggaggagccgctgggccgccagctgtgggcc
gccgtgcaggcccaggacgtggctaccgttctcctgcttttggcccatgcgcgacacggg
ccgctcgacaccagcgtagaggacccacagctgcgctccccactccacctggcggccgag
ctcgcccacgtcgtcatcacgcaactgctgctgtggtacggcgcggacgtggcggcccgt
gacgcccagggccgcacggcgctgttctacgcccgccaggctggaagccagctgtgcgcc
gacatccttctccagcacggctgcccgggtgagggcggcagcgcggccaccacgcccagc
gcggccaccacgcccagcatcaccgccacgcccagcccccgccgccggagcagcgccgct
agcgtgggccgcgccgacgccccggttgcgctggtatag

KEGG   Homo sapiens (human): 116987Help
Entry
116987            CDS       T01001                                 

Gene name
AGAP1, AGAP-1, CENTG2, GGAP1, cnt-g2
Definition
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 1
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116987 (AGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116987 (AGAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    116987 (AGAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap Ras PH Ank_2 Ank Ank_5 Ank_4 Ank_3 Roc PH_6
Motif
Other DBs
NCBI-GeneID: 116987
NCBI-ProteinID: NP_001032208
OMIM: 608651
HGNC: 16922
Ensembl: ENSG00000157985
Vega: OTTHUMG00000133293
Pharos: Q9UPQ3(Tbio)
UniProt: Q9UPQ3 B2RZG9
LinkDB All DBs
Position
2q37.2
AA seq 857 aa AA seqDB search
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNS
QEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL
LIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSI
GPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPT
ANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI
SSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQ
WSEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKA
DGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNK
SRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSR
VRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPSVDSTREEKERWIRAKYEQKL
FLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKG
NVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLS
RRNNNRNNSSGRVPTII
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagcagcagctggccaactcggctgccatccgggccgagatccagcgcttc
gagtcggtccaccccaacatctactccatctacgagctgctggagcgcgtggaggagccg
gtgctgcagaaccagatccgggagcacgtcatcgccatcgaagatgccttcgtgaacagc
caggaatggacgctgagtcgatctgtcccggagctcaaagtgggaattgtgggtaacttg
gccagcggcaagtctgccctggtgcaccggtacctgacgggcacatatgtccaggaggag
tctccggaaggtggcaggttcaagaaagagattgtcgttgatggacagagctatctgctg
ctgatcagagatgaagggggccccccggaggcgcagtttgccatgtgggtggacgctgtt
atatttgtcttcagcttggaggatgaaataagtttccagaccgtttaccactactacagt
cgaatggccaactatcggaacacgagcgagattcctctggttctggtgggaacccaggat
gccataagttctgctaacccgagggtcatcgatgacgccagggcgaggaagctctccaac
gacctgaaacggtgcacgtactacgagacgtgtgctacatacgggctgaatgtggagagg
gtcttccaggacgttgcccagaagattgttgccacaaggaagaagcagcagctgtccata
ggaccctgcaagtcgctacctaattctcccagccattcctccgtctgttccgcgcaggtg
tctgccgtgcacatcagccagacaagtaatggaggtgggagtttaagcgactattcctcc
tccgttccatcgactcccagcaccagccagaaggaacttcggatcgatgttcctcccact
gccaacacgcccacgcccgttcgcaagcagtctaagcgccggtccaacctgttcacctct
cggaaagggagcgacccagacaaagagaagaaaggcctggagagtcgtgcggacagcatt
gggagcggccgagccatcccaattaaacagggcatgctgttgaagcgaagtggcaaatcg
ttgaataaagagtggaaaaagaaatatgtcaccctgtgtgacaatggcgtgctgacctat
catcccagtttacatgattacatgcagaatgttcatggtaaggagattgaccttctgaga
accactgtgaaagtcccagggaagaggccaccccgagccacgtcagcctgcgcacccatc
tccagccctaaaaccaatggcctatccaaggacatgagcagtttacacatctcacccaat
tcagggaatgtcactagtgcatctgggtctcagatggcaagcggcatcagcctggtctcc
ttcaacagccgacccgacggcatgcaccagcgctcctactcagtctccagtgccgaccag
tggagtgaggctacggtcattgcaaactcggccatcagcagtgacacagggctgggtgac
tccgtatgctccagccccagtatctccagcaccaccagccccaagctcgacccgcccccc
tcccctcacgccaacagaaagaagcaccgaaggaagaaaagcactagcaacttcaaagcc
gacggcctgtccggcactgctgaagaacaagaagaaaattttgagtttatcattgtgtcc
ctcactggccaaacatggcactttgaagccacgacgtatgaggagcgggacgcctgggtc
caagccatcgagagccagatcctggccagcctgcagtcgtgcgagagcagcaagaacaag
tcccggctgacgagccagagcgaggccatggccctgcagtcgatccggaacatgcgcggg
aactcccactgtgtggactgcgagacccagaatcccaactgggccagtttgaacttggga
gccctcatgtgcatcgaatgctcagggatccaccggaatcttggcacccacctttcccga
gtccgatctctggacctggatgactggccagtcgagctcatcaaggtgatgtcatccatc
gggaacgagctagccaacagcgtctgggaagagagcagccaggggcggacgaaaccatcg
gtagactccacaagggaagagaaggaacggtggatccgtgccaagtacgagcagaagctc
ttcctggccccgctgccctgcacggagctgtccctgggccagcacctgctgcgggccacc
gccgacgaggacctgcggacggccatcctgctgctggcacacggctcccgggacgaggtg
aacgagacctgcggggagggagacggccgcacggcgctgcatctggcctgccgcaagggg
aatgtggtcctggcgcagctcctgatctggtacggagtggacgtcacggcccgagatgcc
cacgggaacacagctctggcctacgcccggcaggcctccagccaggagtgcatcgacgtg
ctgctgcagtacggctgccccgacgagcgcttcgtgctcatggccacccctaacctgtcc
aggagaaacaataaccggaacaacagcagtgggagggtgcccaccatcatctga

KEGG   Homo sapiens (human): 116988Help
Entry
116988            CDS       T01001                                 

Gene name
AGAP3, AGAP-3, CENTG3, CRAG, MRIP-1, cnt-g3
Definition
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116988 (AGAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116988 (AGAP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    116988 (AGAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap Ras PH Ank_2 Ank_4 Ank Ank_5 Roc PH_6 Imm30
Motif
Other DBs
NCBI-GeneID: 116988
NCBI-ProteinID: NP_114152
OMIM: 616813
HGNC: 16923
Ensembl: ENSG00000133612
Vega: OTTHUMG00000158724
Pharos: Q96P47(Tdark)
UniProt: Q96P47 Q86XV5
LinkDB All DBs
Structure
PDB: 

Position
7q36.1
AA seq 911 aa AA seqDB search
MNFQAGGGQSPQQQQSLAAPGGGGAAAQQLVCGGQFGGAGPGAGGGGGPSQQLAGGPPQQ
FALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHVISIEDSFVNSQEWT
LSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRD
EGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISA
ANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCK
SLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASST
PTPIRKQSKRRSNIFTSRKGADLDREKKAAECKVDSIGSGRAIPIKQGILLKRSGKSLNK
EWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLPRATPATAPGTSP
RANGLSVERSNTQLGGGTGAPHSASSASLHSERPLSSSAWAGPRPEGLHQRSCSVSSADQ
WSEATTSLPPGMQHPASGPAEVLSSSPKLDPPPSPHSNRKKHRRKKSTGTPRPDGPSSAT
EEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKTRLGNQN
AALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLD
DWPPELLAVMTAMGNALANSVWEGALGGYSKPGPDACREEKERWIRAKYEQKLFLAPLPS
SDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQL
LIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPNREPANGTNP
SAELHRSPSLL
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgaacttccaggcgggcggggggcagagcccgcagcagcagcagagcctggcggctccg
gggggcggcggcgctgccgcgcagcagctcgtctgcggcgggcagttcggcggcgcgggg
cccggggccgggggcggcggcggcccctcgcagcagctggccggcgggcccccccagcag
ttcgcgctctccaactccgcggccatccgggccgagatccagcgcttcgagtccgtgcat
cccaatatctacgccatctacgacctgatcgagcgcatcgaggatttggcgctgcagaac
cagatccgggagcacgtcatctccatcgaggactcgtttgtgaacagccaggagtggacg
ctgagccgctccgtaccggagcttaaagtgggcatagtggggaacctgtctagcgggaag
tcagccctggtgcaccgctatctgacggggacctatgtccaggaggagtcccctgaaggg
gggcggtttaagaaggagattgtggtggatggccagagttacctgctgctgatccgagat
gaaggaggcccccctgagctccagtttgctgcctgggtggatgcagtggtgtttgtgttc
agcctggaggatgaaatcagtttccagacggtgtacaactacttcctgcgtctctgcagc
ttccgcaacgccagcgaggtgcccatggtgcttgtgggcacgcaggatgccatcagcgct
gcgaatccccgggttatcgacgacagcagagcccgcaagctctccacagatctgaagcgg
tgcacctactatgagacgtgcgcgacctacgggctcaatgtggagcgtgtcttccaggac
gtggcccagaaggtagtggccttgcgaaagaagcagcaactggccatcgggccctgcaag
tcactgcccaactcgcccagccactcggccgtgtccgccgcctccatcccggccgtgcac
atcaaccaggccacgaatggcggcggcagcgccttcagcgactactcgtcctcagtcccc
tccacccccagcatcagccagcgggagctgcgcatcgagaccatcgctgcctcctccacc
cccacacccatccgaaagcagtccaagcggcgctccaacatcttcacgtctcggaagggt
gctgacctggaccgggagaagaaggctgccgagtgcaaggtggacagcatcgggagcggc
cgcgccatccccatcaagcaggggatcctgctaaagcggagcggcaagtccctgaacaag
gagtggaagaagaagtatgtgacgctctgtgacaacgggctgctcacctatcaccccagc
ctgcatgattacatgcagaacatccacggcaaggagattgacctgctgcggacaacggtg
aaagtgccagggaagcgcctgccccgagccacacctgccacagccccgggcaccagcccc
cgtgccaacgggctgtccgtggagcggagtaacacacagctgggtgggggcacaggtgcc
ccccactcggccagcagcgcatccctgcactctgagcgccccctcagcagctcggcctgg
gctggcccgcgccctgaggggctgcaccagcgctcctgctccgtttccagcgccgaccag
tggagtgaggccaccacttccctgcccccaggcatgcagcaccctgccagtggcccagct
gaggtactcagttccagccccaagctggatcctcccccatctccccactccaaccggaag
aagcaccggaggaaaaagagcaccgggaccccccgaccagacggccccagcagtgctact
gaagaggcagaggagtcgtttgaatttgtggtggtgtccctcactgggcagacgtggcac
ttcgaggcttcaacggcggaggagcgggagctgtgggttcagagtgtgcaggcccagatc
cttgccagcctgcaaggctgccgcagtgccaaggacaagactcgactggggaaccagaac
gcagctctggctgtgcaggccgtccgcaccgtccgcggcaacagcttttgtatcgactgc
gatgcacccaatccagactgggccagcctgaacctgggtgccctgatgtgcattgagtgc
tcaggcatccaccgacacctgggggctcacctgtcccgggtgcgctcccttgacctcgat
gactggccgcctgagctgctggctgtcatgactgccatgggcaatgccctcgccaacagc
gtctgggagggggccttgggtggctactccaagccagggcctgatgcctgcagagaggag
aaggaacgctggatacgggccaagtatgaacagaagctcttcctggccccactgccaagc
tcagatgtgccactggggcagcagctgctccgggccgtggtggaagatgacctgcggctg
ttggtgatgctcctggcacatggctccaaagaggaggtgaatgagacctatggggacggg
gacgggcggacggctctacatctctccagtgccatggccaacgttgtcttcacgcagctg
ctcatctggtacggggtggacgtgaggagccgggacgcccggggcctgactccactggca
tatgctcgccgggccggcagccaggagtgtgcagacatcttgatccagcatggctgccct
ggggagggctgtggcttagcgcctacccccaacagagagcctgccaatggcaccaacccc
tctgctgagctgcaccgtagtcctagcctcctataa

KEGG   Homo sapiens (human): 23527Help
Entry
23527             CDS       T01001                                 

Gene name
ACAP2, CENTB2, CNT-B2
Definition
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23527 (ACAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23527 (ACAP2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23527 (ACAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    23527 (ACAP2)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    23527 (ACAP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   23527 (ACAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 ArfGap Ank_2 PH Ank_5 Ank Ank_4 Ank_3 PH_8 PH_11
Motif
Other DBs
NCBI-GeneID: 23527
NCBI-ProteinID: NP_036419
OMIM: 607766
HGNC: 16469
Ensembl: ENSG00000114331
Vega: OTTHUMG00000155885
Pharos: Q15057(Tdark)
UniProt: Q15057
LinkDB All DBs
Structure
PDB: 

Position
3q29
AA seq 778 aa AA seqDB search
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSI
ATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNASCCDCGLA
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYE
ANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLS
ISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLD
SKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFL
LQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANA
DIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgactgtggatttcgaggagtgtctgaaggactcgccccgcttcagggcagct
ttggaagaagtagaaggtgatgtggcagaattggaactaaaacttgataagcttgtgaaa
ctttgtattgcaatgattgatactggaaaagccttttgtgttgcaaataaacagttcatg
aatgggattcgagacctggctcagtattctagtaatgatgctgtcgttgagacaagtttg
accaagttttctgacagtcttcaagaaatgataaattttcacacaatcctgtttgaccaa
actcagagatcaattaaggcacagcttcagaactttgttaaagaagatcttagaaaattc
aaagatgccaagaagcaattcgaaaaagtcagtgaagaaaaagaaaatgcgttagtaaaa
aatgcccaagtacaaagaaacaaacaacatgaagttgaagaagccaccaacattctgaca
gcaacaagaaaatgtttccgacacatagccctcgattatgtgcttcagattaatgttctt
caatcaaaaaggagatcagaaatcctaaaatcaatgttgtcatttatgtatgcccatttg
gccttctttcatcaaggatatgatctgtttagtgaacttggaccctacatgaaggatctt
ggtgcacagttggatcgactggttgtggatgcagcaaaggagaaaagagaaatggagcaa
aaacattccaccattcaacaaaaggatttctccagtgatgattctaagttagaatataac
gtagatgctgcaaatggcatagttatggaaggatatctgttcaaacgagccagcaatgcc
ttcaaaacttggaacaggcgctggttttcaatacagaataatcagttggtttaccagaaa
aaatttaaggataatccgactgtggtagttgaagacctcaggctttgcacagtgaaacat
tgtgaagacatagagcgacgattctgctttgaggtggtctcgccaacaaaaagttgcatg
ctccaggcagattccgaaaagctgcgccaggcatggattaaggctgttcagaccagtatt
gctactgcttatagagagaagggtgatgaatcagagaagctggataagaaatcatctcca
tccacaggaagcctagattctggaaatgagtccaaagagaaattattgaaaggagaaagt
gcgcttcagcgggtccagtgtatccctggcaatgccagctgttgtgactgtggcctggca
gatccacggtgggccagcatcaacctgggcatcaccttgtgtatcgagtgctccggaatt
caccggagccttggggttcatttttcaaaagtacgatctttaactttagacacctgggag
ccagaacttttaaagcttatgtgtgagttggggaatgatgttataaatcgagtttatgaa
gctaatgtggaaaaaatgggaataaagaaaccccaaccaggacaaagacaggagaaggag
gcatatatcagagcaaaatatgtggagaggaaatttgtggataaatattctatatcatta
tcacctcctgagcagcaaaaaaagtttgtctctaaaagttctgaagaaaagaggctgagc
atttctaaatttgggccaggggaccaagtcagagcatctgcccaaagttcagtcagaagt
aatgacagtggaattcagcagagctctgatgatggaagagaatctttaccctccacggtg
tcagccaatagtttatatgagcctgaaggagaaaggcaagattcttctatgtttcttgac
tcgaaacatcttaatccaggacttcagctttatagggcgtcatatgaaaaaaaccttcct
aaaatggctgaggctttggctcatggtgcagacgtgaactgggccaattcagaggaaaac
aaagcgacaccacttattcaggctgtattagggggctctttggtgacgtgtgagttcctc
ctacagaatggtgctaatgtcaaccaaagagatgtccaagggcggggaccattgcaccat
gccaccgtcttagggcacacagggcaggtatgtttattcctaaaacgaggtgccaatcaa
catgccactgatgaagaagggaaagaccctttgagcatagctgtggaagcagccaatgct
gatatagtcaccttgttacgtttagcaagaatgaatgaagagatgcgggaatcagaagga
ctttatggacagccaggtgatgaaacttatcaggacatatttcgtgatttttcccaaatg
gcatccaataatccagagaaactaaatcgtttccagcaagattcacagaaattctga

KEGG   Homo sapiens (human): 26286Help
Entry
26286             CDS       T01001                                 

Gene name
ARFGAP3, ARFGAP1
Definition
(RefSeq) ADP ribosylation factor GTPase activating protein 3
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    26286 (ARFGAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26286 (ARFGAP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    26286 (ARFGAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap TMF_DNA_bd
Motif
Other DBs
NCBI-GeneID: 26286
NCBI-ProteinID: NP_055385
OMIM: 612439
HGNC: 661
Ensembl: ENSG00000242247
Vega: OTTHUMG00000150718
Pharos: Q9NP61(Tbio)
UniProt: Q9NP61 A0A024R4U0
LinkDB All DBs
Structure
PDB: 

Position
22q13.2
AA seq 516 aa AA seqDB search
MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSL
ASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPV
ETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANT
CFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNV
DSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEP
VELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLP
NAPDMAQFKQGVRSVAGKLSVFANGVVTSIQDRYGS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgggggaccccagcaagcaggacatcttgaccatcttcaagcgcctccgctcggtgccc
actaacaaggtgtgttttgattgtggtgccaaaaatcccagctgggcaagcataacctat
ggagtgttcctttgcattgattgctcagggtcccaccggtcacttggtgttcacttgagt
tttattcgatctacagagttggattccaactggtcatggtttcagttgcgatgcatgcaa
gtcggaggaaacgctagtgcatcttccttttttcatcaacatgggtgttccaccaatgac
accaatgccaagtacaacagtcgtgctgctcagctctatagggagaaaatcaaatcgctc
gcctctcaagcaacacggaagcatggcactgatctgtggcttgatagttgtgtggttcca
cctttgtcccctccaccaaaggaggaagatttttttgcctctcacgtttctcctgaggtg
agtgacacagcgtgggcatcagcaatagcagaaccatcttctttaacatcaaggcctgtg
gaaaccactttggaaaataatgaaggtggacaagagcaaggaccaagtgtggaaggtctt
aatgtaccaacaaaggctactttagaggtatcctctatcataaaaaagaaaccaaatcaa
gctaaaaaaggccttggggccaaaaaaggaagtttgggagctcagaaactggcaaacaca
tgctttaatgaaattgaaaaacaagctcaagctgcggataaaatgaaggagcaggaagac
ctggccaaggtggtatctaaagaagaatcaattgtttcatcattacgattagcctataag
gatcttgaaattcaaatgaagaaagacgaaaagatgaacattagtggcaaaaaaaatgtt
gactcagacagactcggcatgggatttggaaattgcagaagtgttatttcacattcagtg
acttcagatatgcagaccatagagcaggaatcacccattatggcaaaaccaagaaaaaag
tataatgatgacagtgacgattcatattttacttccagctcaagttactttgacgagcca
gtggagttaaggagcagttctttctctagctgggatgacagttcagattcctattggaaa
aaagagaccagcaaagatactgaaacagttctgaaaaccacaggctattcagacagacct
actgctcgccgcaagccagattatgagccagttgaaaatacagatgaggcccagaagaag
tttggcaatgtcaaggccatttcatcagatatgtattttggaagacaatcccaggctgat
tatgagaccagggcccgcctagagaggctgtcggcaagttcctccataagctcggctgat
ctgttcgaggagccgaggaagcagccagcagggaactacagcctgtccagtgtgctgccc
aacgcccccgacatggcgcagttcaagcagggagtgagatcggttgctggaaaactctcc
gtctttgctaatggagtcgtgacttcaattcaggatcgctacggttcttaa

KEGG   Homo sapiens (human): 28964Help
Entry
28964             CDS       T01001                                 

Gene name
GIT1
Definition
(RefSeq) GIT ArfGAP 1
  KO
K05737  G protein-coupled receptor kinase interactor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    28964 (GIT1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    28964 (GIT1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    28964 (GIT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    28964 (GIT1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    28964 (GIT1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    28964 (GIT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_4 Ank_5 Ank Shugoshin_N ZapB TTRAP YabA WDCP
Motif
Other DBs
NCBI-GeneID: 28964
NCBI-ProteinID: NP_054749
OMIM: 608434
HGNC: 4272
Ensembl: ENSG00000108262
Vega: OTTHUMG00000132730
Pharos: Q9Y2X7(Tbio)
UniProt: Q9Y2X7
LinkDB All DBs
Position
17q11.2
AA seq 761 aa AA seqDB search
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQ
NHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSL
SSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGA
VTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPT
PPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELE
DDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYEN
TQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELL
RAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTV
PPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaaaggggccgcgagcggaggtgtgtgcggactgcagcgccccggaccctggc
tgggcatccatcagcaggggtgtgctggtgtgtgacgagtgctgcagcgtgcaccggagc
ctgggacgccacatctccattgtcaagcaccttcgccacagcgcctggcctcccacgctg
ctgcagatggtgcacacgcttgccagcaacggggccaactccatctgggagcactccctg
ctggaccccgcacaagtgcagagcggccggcgtaaagccaacccccaagacaaagtccac
cccatcaagtcagagttcatcagggccaagtaccagatgctggcatttgtgcacaagctt
ccctgccgggacgatgatggagtcaccgccaaagacctcagcaagcaactacactcgagc
gtgcggacaggcaacctggagacatgtctgcgcctgctctccctgggtgcccaggccaac
ttcttccacccagagaagggcaccacacctctgcacgtggctgccaaggcaggacagaca
ctgcaggccgagctgcttgtagtgtatggggctgaccctggctcccctgatgttaatggc
cgcacacccattgactatgccaggcaggcggggcaccatgagctggcggaaaggctggtt
gagtgccaatatgagctcactgaccggctggccttctacctctgtggacgcaagccggat
cacaagaatgggcattacatcatcccacagatggctgacagccttgacttatccgaattg
gccaaagctgctaagaagaagctgcaggcgctcagcaaccggctttttgaggaactcgcc
atggacgtgtatgacgaggtggatcgaagagaaaatgatgcagtgtggctggctacccaa
aaccacagcactctggtgacagagcgcagtgccgtgcccttcctgcctgttaacccggaa
tactcagccacgcggaatcaggggcgacaaaagctggcccgctttaatgcccgagagttt
gccaccttgatcatcgacattctcagtgaggccaagcggagacagcagggcaagagcctg
agcagccccacagacaacctcgagctgtctctgcggagccagagtgacctcgacgaccaa
cacgactacgacagcgtggcctctgacgaggacacagaccaggagcccctgcgcagcacc
ggcgccactcggagcaaccgggcccggagcatggactcctcggacttgtctgacggggct
gtgacgctgcaggagtacctggagctgaagaaggccctggctacatcggaggcaaaggtg
cagcagctcatgaaggtcaacagtagcctgagcgacgagctccggaggctgcagcgagag
atccacaagctgcaggcggagaacctgcagctccggcagcctccagggccggtgcccaca
cctccactccccagtgaacgggcggaacacacacccatggcgccaggcgggagcacacac
cgcagggatcgccaggccttttccatgtatgaacctggctctgccctgaagccctttggg
ggcccccctggggacgagctcactacgcggctgcagcctttccacagcactgagctagag
gacgacgccatctattcagtgcacgtccctgctggcctttaccggatccggaaaggggtg
tctgcctcagctgtgcccttcactccctcctccccgctgctgtcctgctcccaggaggga
agccgccacacgagcaagctttcccgccacggcagtggagccgacagtgactatgagaac
acgcaaagtggggacccactgctggggctggaagggaagaggtttctagagctgggcaaa
gaggaagacttccacccagagctggaaagcctggatggagacctagatcctgggcttccc
agcacagaggatgtcatcttgaagacagagcaggtcaccaagaacattcaggaactgttg
cgggcagcccaggagttcaagcatgacagcttcgtgccctgctcagagaagatccatttg
gctgtgaccgagatggcctccctcttcccaaagaggccagccctggagccagtgcggagc
tcactgcggctgctcaacgccagcgcctaccggctgcagagtgagtgccggaagacagtg
cccccagagcccggcgccccagtggacttccagctgctgactcagcaggtgatccagtgc
gcctatgacatcgccaaggctgccaagcagctggtcaccatcaccacccgagagaagaag
cagtga

KEGG   Homo sapiens (human): 50807Help
Entry
50807             CDS       T01001                                 

Gene name
ASAP1, AMAP1, CENTB4, DDEF1, PAG2, PAP, ZG14P
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    50807 (ASAP1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    50807 (ASAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    50807 (ASAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    50807 (ASAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_1 BAR SH3_9 Ank SH3_2 Ank_4 Ank_3 Ank_5 PH_3
Motif
Other DBs
NCBI-GeneID: 50807
NCBI-ProteinID: NP_060952
OMIM: 605953
HGNC: 2720
Ensembl: ENSG00000153317
Vega: OTTHUMG00000164772
Pharos: Q9ULH1(Tbio)
UniProt: Q9ULH1
LinkDB All DBs
Structure
PDB: 

Position
8q24.21-q24.22
AA seq 1129 aa AA seqDB search
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEIDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSLDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgagatcttcagcctccaggctctccagtttttcgtcgagagattcactatggaatcgg
atgccggaccagatctctgtctcggagttcatcgccgagaccaccgaggactacaactcg
cccaccacgtccagcttcaccacgcggctgcacaactgcaggaacaccgtcacgctgctg
gaggaggctctagaccaagatagaacagcccttcagaaagtgaagaagtctgtaaaagca
atatataattctggtcaagatcatgtacaaaatgaagaaaactatgcacaagttcttgat
aagtttgggagtaattttttaagtcgagacaaccccgaccttggcaccgcgtttgtcaag
ttttctactcttacaaaggaactgtccacactgctgaaaaatctgctccagggtttgagc
cacaatgtgatcttcaccttggattctttgttaaaaggagacctaaagggagtcaaagga
gatctcaagaagccatttgacaaagcctggaaagattatgagacaaagtttacaaaaatt
gagaaagagaaaagagagcacgcaaaacaacatgggatgatccgcacagagataacagga
gctgagattgcggaagaaatggagaaggaaaggcgcctctttcagctccaaatgtgtgaa
tatctcattaaagttaatgaaatcaagaccaaaaagggtgtggatctgctgcagaatctt
ataaagtattaccatgcacagtgcaatttctttcaagatggcttgaaaacagctgataag
ttgaaacagtacattgaaaaactggctgctgatttatataatataaaacagacccaggat
gaagaaaagaaacagctaactgcactccgagacttaataaaatcctctcttcaactggat
cagaaagaagattctcagagccggcaaggaggatacagcatgcatcagctccagggcaat
aaggaatatggcagtgaaaagaaggggtacctgctaaagaaaagtgacgggatccggaaa
gtatggcagaggaggaagtgttcagtcaagaatgggattctgaccatctcacatgccaca
tctaacaggcaaccagccaagttgaaccttctcacctgccaagtaaaacctaatgccgaa
gacaaaaaatcttttgacctgatatcacataatagaacatatcactttcaggcagaagat
gagcaggattatgtagcatggatatcagtattgacaaatagcaaagaagaggccctaacc
atggccttccgtggagagcagagtgcgggagagaacagcctggaagacctgacaaaagcc
attattgaggatgtccagcggctcccagggaatgacatttgctgcgattgtggctcatca
gaacccacctggctttcaaccaacttgggtattttgacctgtatagaatgttctggcatc
catagggaaatgggggttcatatttctcgcattcagtctttggaactagacaaattagga
acttctgaactcttgctggccaagaatgtaggaaacaatagttttaatgatattatggaa
gcaaatttacccagcccctcaccaaaacccaccccttcaagtgatatgactgtacgaaaa
gaatatatcactgcaaagtatgtagatcataggttttcaaggaagacctgttcaacttca
tcagctaaactaaatgaattgcttgaggccatcaaatccagggatttacttgcactaatt
caagtctatgcagaaggggtagagctaatggaaccactgctggaacctgggcaggagctt
ggggagacagcccttcaccttgccgtccgaactgcagatcagacatctctccatttggtt
gacttccttgtacaaaactgtgggaacctggataagcagacggccctgggaaacacagtt
ctacactactgtagtatgtacagtaaacctgagtgtttgaagcttttgctcaggagcaag
cccactgtggatatagttaaccaggctggagaaactgccctagacatagcaaagagacta
aaagctacccagtgtgaagatctgctttcccaggctaaatctggaaagttcaatccacac
gtccacgtagaatatgagtggaatcttcgacaggaggagatagatgagagcgatgatgat
ctggatgacaaaccaagccctatcaagaaagagcgctcacccagacctcagagcttctgc
cactcctccagcatctccccccaggacaagctggcactgccaggattcagcactccaagg
gacaaacagcggctctcctatggagccttcaccaaccagatcttcgtttccacaagcaca
gactcgcccacatcaccaaccacggaggctccccctctgcctcctaggaacgccgggaaa
ggtccaactggcccaccttcaacactccctctaagcacccagacctctagtggcagctcc
accctatccaagaagaggcctcctcccccaccacccggacacaagagaaccctatccgac
cctcccagcccactacctcatgggcccccaaacaaaggcgcagttccttggggtaacgat
gggggtccatcctcttcaagtaagactacaaacaagtttgagggactatcccagcagtcg
agcaccagttctgcaaagactgcccttggcccaagagttcttcctaaactacctcagaaa
gtggcactaaggaaaacagatcatctctccctagacaaagccaccatcccgcccgaaatc
tttcagaaatcatcacagttggcagagttgccacaaaagccaccacctggagacctgccc
ccaaagcccacagaactggcccccaagccccaaattggagatttgccgcctaagccagga
gaactgccccccaaaccacagctgggggacctgccacccaaaccccaactctcagactta
cctcccaaaccacagatgaaggacctgccccccaaaccacagctgggagacctgctagca
aaatcccagactggagatgtctcacccaaggctcagcaaccctctgaggtcacactgaag
tcacacccattggatctatccccaaatgtgcagtccagagacgccatccaaaagcaagca
tctgaagactccaacgacctcacgcctactctgccagagacgcccgtaccactgcccaga
aaaatcaatacggggaaaaataaagtgaggcgagtgaagaccatttatgactgccaggca
gacaacgatgacgagctcacattcatcgagggagaagtgattatcgtcacaggggaagag
gaccaggagtggtggattggccacatcgaaggacagcctgaaaggaagggggtctttcca
gtgtcctttgttcatatcctgtctgactag

KEGG   Homo sapiens (human): 55616Help
Entry
55616             CDS       T01001                                 

Gene name
ASAP3, ACAP4, CENTB6, DDEFL1, UPLC1
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55616 (ASAP3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    55616 (ASAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55616 (ASAP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    55616 (ASAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap BAR_3 PH Ank_2 Ank_5 Ank_4 Ank Ank_3 DUF3287 PH_2 PH_3 PH_13
Motif
Other DBs
NCBI-GeneID: 55616
NCBI-ProteinID: NP_060177
OMIM: 616594
HGNC: 14987
Ensembl: ENSG00000088280
Vega: OTTHUMG00000003234
Pharos: Q8TDY4(Tbio)
UniProt: Q8TDY4 A0A024RAB1
LinkDB All DBs
Structure
PDB: 

Position
1p36.12
AA seq 903 aa AA seqDB search
MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNL
NNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGIPGEVAQ
DMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFI
EKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ
FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGE
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQS
LTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRF
ARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQA
SLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALD
IARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAH
WASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCARHASGDRSEVS
SLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPS
EMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQL
LQD
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgccggagcagttcagcgtcgccgagttcctggccgtcaccgcggaggacctcagctcc
ccggctggggccgccgccttcgccgccaagatgccccggtaccgaggggcggcgctggcg
cgggaggagatcttggaaggagaccaagccatcctgcagagaataaagaaggctgtgcgg
gcaatccatagctccggccttggccatgtggagaatgaagagcagtaccgagaggccgtg
gaatccttaggcaacagccacctgtcccagaacagccatgagctgtccacaggcttccta
aacttggccgtgttcacccgcgaggttgctgcgctcttcaagaacctgattcagaacttg
aacaacattgtctctttccccctggacagtctgatgaaggggcagctgagggacggtcga
caggattccaaaaaacagctggagaaggcatggaaggactatgaagccaaaatggccaag
ctggagaaggagcgcgatcgggccagggtgacaggagggatccctggggaggtggcccag
gacatgcagagagagcggcgcatcttccagctgcacatgtgtgagtatctgctcaaagcc
ggggagagccagatgaagcaaggtcctgacttccttcagagcctcatcaagttcttccac
gcccagcacaactttttccaagatggctggaaggctgcccagagcctgttccccttcatc
gagaagctggcggcctcagtacatgcactccatcaggcccaggaggacgagctacagaag
ctgacccagctccgggactccctccgagggacactgcagcttgagagcagagaggaacac
ctgagccggaagaactcaggatgtggctatagcatccaccagcaccaaggcaacaagcag
tttgggacggagaaagtgggctttctatacaagaaaagtgacggaattcgaagagtctgg
cagaaaaggaagtgtggagtcaagtatggctgcctgaccatctcacacagcacgataaac
cggcccccggtgaagctgaccctgctgacgtgccaagtgaggccaaaccctgaggagaaa
aagtgcttcgacctggtgacccacaaccggacgtaccactttcaggcagaggacgagcac
gagtgtgaggcgtgggtgtcagtgttgcagaacagcaaggacgaagccctgagcagcgcc
ttcctcggggagcccagcgctggcccggggtcctgggggtccgccggccatgatggggag
ccgcacgacctcacaaagctgctcatcgcggaggtgaagagcaggcctgggaatagccag
tgctgcgactgcggggctgcagaccccacgtggctcagcaccaacctgggcgtgctcacc
tgcatccagtgctcgggcgtccaccgcgaactgggcgtgcgcttttcgcgcatgcagtca
ctcaccttggacctgctgggcccctccgagttgttgctggccttgaacatgggaaacacg
agcttcaatgaggtcatggaggcccagctaccctcacacggcggccctaaaccctcagct
gagagtgacatgggcacccgcagggactacattatggccaagtatgtggagcataggttt
gcacgccggtgcacacctgagcctcagcgactctggacagccatttgcaacagggacctc
ctgtcggtactggaggcctttgccaatgggcaggactttggacagccgctgccagggcct
gatgcacaggcacctgaagaactcgtcttgcatttggctgtcaaagtcgccaaccaggct
tccctgcctctggtggatttcatcatccagaacggtggtcacctggatgccaaggctgct
gacgggaacacggctctgcactacgcagcactctacaaccagcccgactgcctcaagctg
ctgctgaaggggagagctttggttggcacagtaaatgaagcaggcgagacagctctggac
atagccaggaagaagcaccacaaggagtgtgaggagctgctggagcaggcccaggcgggg
acctttgccttccctctacatgtggactactcctgggtaatttccacagagcctggctct
gacagtgaggaggatgaggaagagaagcgctgcttgctgaagctcccggcccaggctcac
tgggccagtgggaggctggacatcagcaacaagacctatgagactgtcgccagcctggga
gcagccacccctcagggcgagagtgaggactgtcccccgcccttgccagtcaaaaactct
tctcggactttggtccaagggtgtgcaagacatgccagtggagatcgttctgaagtctcc
agcctgagttcagaggcccctgagacccctgagagcctgggcagtccagcctcctcctcc
agtctgatgagccccttggaacctggggatcccagccaagccccacccaactctgaagag
ggcctccgagagcccccaggcacctccagacccagcctgacatccgggaccaccccttcg
gagatgtacctccccgtcagattcagctccgagagcactcgctcctatcggcggggggcg
cggagccctgaagatggtccctcagccaggcagcctctgcccagaaggaacgtgccggtt
ggcatcactgaaggagatggctcaaggactgggagtctcccagcaagttctgtgcaactt
ttgcaagactag

KEGG   Homo sapiens (human): 55738Help
Entry
55738             CDS       T01001                                 

Gene name
ARFGAP1, ARF1GAP, HRIHFB2281
Definition
(RefSeq) ADP ribosylation factor GTPase activating protein 1
  KO
K12492  ADP-ribosylation factor GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55738 (ARFGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55738 (ARFGAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    55738 (ARFGAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap zf-piccolo
Motif
Other DBs
NCBI-GeneID: 55738
NCBI-ProteinID: NP_060679
OMIM: 608377
HGNC: 15852
Ensembl: ENSG00000101199
Vega: OTTHUMG00000032965
Pharos: Q8N6T3(Tbio)
UniProt: Q8N6T3 Q53F62
LinkDB All DBs
Structure
PDB: 

Position
20q13.33
AA seq 406 aa AA seqDB search
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
GREWSLESSPAQNWTPPQPRTLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQG
NRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEG
PLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRS
SDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggccagcccaagaaccaggaaggttcttaaagaagtcagggtgcaggatgagaacaac
gtttgttttgagtgtggcgcgttcaatcctcagtgggtcagtgtgacctacggcatctgg
atctgcctggagtgctcggggagacaccgcgggcttggggttcacctcagctttgtgcgc
tctgttactatggacaagtggaaggacattgagcttgagaagatgaaagctggtgggaat
gctaagttccgagagttcctggagtctcaggaggattacgatccttgctggtccttgcag
gagaagtacaacagcagagccgcggccctctttagggataaggtggtcgctctggccgaa
ggcagagagtggtctctggagtcatcacctgcccagaactggaccccacctcagcccagg
acgctgccgtccatggtgcaccgagtctctggccagccgcagagtgtgaccgcctcctcg
gacaaggcttttgaagactggctgaatgatgacctcggctcctatcaaggggcccagggg
aatcgctacgtggggtttgggaacacgccaccgcctcagaagaaagaagatgacttcctc
aacaacgccatgtcctccctgtactcgggctggagcagcttcaccactggagccagccgg
tttgcctcggcagccaaggagggcgctacaaagtttggatcccaagcgagtcagaaggcg
tccgagctgggccacagcctgaacgagaacgtcctcaagcctgcgcaggagaaggtgaag
gagggaaagatttttgatgatgtctccagtggggtctctcagttggcgtccaaggtccag
ggagtcggtagtaagggatggcgggacgtcaccacctttttttcggggaaagcagagggc
cccttggacagcccctcggagggccacagttatcagaacagcggtctggaccacttccaa
aacagcaacatagaccagagcttctgggagacctttggaagtgctgagcccaccaagacc
cgcaagtccccgagcagcgacagctggacgtgcgcggacacctccaccgagaggaggagc
tcggacagctgggaggtgtggggctcggcctccaccaacaggaacagcaacagcgacggc
ggggagggcggggagggcaccaagaaggcagtgccgccggccgtgcccactgatgatggc
tgggacaaccagaactggtag

KEGG   Homo sapiens (human): 60682Help
Entry
60682             CDS       T01001                                 

Gene name
SMAP1, SMAP-1
Definition
(RefSeq) small ArfGAP 1
  KO
K12486  stromal membrane-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    60682 (SMAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    60682 (SMAP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    60682 (SMAP1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    60682 (SMAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap EMC3_TMCO1 DUF3824 SR-25 DUF2027
Motif
Other DBs
NCBI-GeneID: 60682
NCBI-ProteinID: NP_001037770
OMIM: 611372
HGNC: 19651
Ensembl: ENSG00000112305
Vega: OTTHUMG00000014996
Pharos: Q8IYB5(Tbio)
UniProt: Q8IYB5
LinkDB All DBs
Structure
PDB: 

Position
6q13
AA seq 467 aa AA seqDB search
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKEEKKREKE
PEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLN
DDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQL
SKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVM
GQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWS
LSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcgctcctgtcgggagaaggctcagaagctgaacgagcagcaccagctcatc
ctatccaagcttctgagggaggaggacaacaagtactgcgccgactgcgaggccaaaggt
cctcgatgggcttcctggaatattggtgtgtttatttgcatcagatgtgctggaattcat
agaaatcttggggttcatatatccagggtcaaatcagtcaacctagaccaatggacagca
gaacagatacagtgcatgcaagatatgggaaatactaaagcaagactactctatgaagcc
aatcttccagagaactttcgaagaccacagacagatcaagcagtggaatttttcatcaga
gataaatatgaaaagaagaaatactacgataaaaatgccatagctattacaaatatttcc
tcctctgatgctcctcttcagcctttggtatcctctccttctctgcaagctgctgttgac
aaaaataaattggagaaagaaaaggaaaaaaaaaaggaagagaaaaagagagaaaaggag
ccagaaaagccggcaaaaccacttacagctgaaaagctgcagaagaaagatcagcaactg
gagcctaaaaaaagtaccagccctaaaaaagctgcggagcccactgtggatcttttagga
cttgatggccctgctgtggcaccagtgaccaacgggaacacaacggtgccacccctgaac
gatgatctggacatctttggaccgatgatttctaatcccttacctgcaactgtcatgccc
ccagctcaggggacaccctctgcaccagcagctgcaaccctgtctacagtaacatctggg
gatctagatttattcactgagcaaactacaaaatcagaagaagtggcaaagaaacaactt
tccaaagactccatcttatctctgtatggcacaggaaccattcaacagcaaagtactcct
ggtgtatttatgggacccacaaatataccatttacctcacaagcaccagctgcatttcag
ggctttccatcgatgggcgtgcctgtgcctgcagctcctggccttataggaaatgtgatg
ggacagagtccaagcatgatggtgggcatgcccatgcccaatgggtttatgggaaatgca
caaactggtgtgatgccacttcctcagaacgttgttggcccccaaggaggaatggtggga
caaatgggtgcaccccagagtaagtttggcctgccgcaagctcagcagccccagtggagc
ctctcacagatgaatcagcagatggctggcatgagtatcagtagtgcaacccctactgca
ggttttggccagccctccagcacaacagcaggatggtctggaagctcatcaggtcagact
ctcagcacacaactgtggaaatga

KEGG   Homo sapiens (human): 64411Help
Entry
64411             CDS       T01001                                 

Gene name
ARAP3, CENTD3, DRAG1
Definition
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3
  KO
K12490  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    64411 (ARAP3)
   04024 cAMP signaling pathway
    64411 (ARAP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64411 (ARAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64411 (ARAP3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    64411 (ARAP3)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    64411 (ARAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP PH ArfGap RA SAM_2 SAM_1 PH_8 PH_3 PH_6 PH_2
Motif
Other DBs
NCBI-GeneID: 64411
NCBI-ProteinID: NP_071926
OMIM: 606647
HGNC: 24097
Ensembl: ENSG00000120318
Vega: OTTHUMG00000129610
Pharos: Q8WWN8(Tbio)
UniProt: Q8WWN8 Q05CH1 Q9H7C1
LinkDB All DBs
Structure
PDB: 

Position
5q31.3
AA seq 1544 aa AA seqDB search
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILR
LLQTGTEEGSLDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTQRPGLSPAL
GGPGVSRSPEPSPRPPPLPTSSSEQSSALNTVEMMPNSIYFGLDSRGRAQAAQDKAPDSS
QISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESRGVCQGRAEHRLSRQDLE
AREDAGYASLELPGDSTLLSPTLETEETSDDLISPYASFSFTADRLTPLLSGWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFR
TESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA
LYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQE
AVTETLSDYEVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISK
VQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRL
GLFRKPHPQYPDHSQLLQALCAAVARPNLLKNMTQLLCVEAFEGEEPWFPPAPDGSCPGL
LPSDPSPGVYNEVVVRATYSGFLYCSPVSNKAGPSPPRRGRDAPPRLWCVLGAALEMFAS
ENSPEPLSLIQPQDIVCLGVSPPPTDPGDRFPFSFELILAGGRIQHFGTDGADSLEAWTS
AVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGLWLSGFGLLRGDHLFLCSAPGP
GPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFTAWNAAIGG
AAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRD
ARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVI
GCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQEL
IDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSP
TLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPEPCS
ASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLK
EKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSI
LKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLS
MFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLT
SQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGETT
AGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccctcaggacctggacatcgctgtgtggctggccacggtgcacctggagcag
tatgcagacacgttccgacggcatggcctggctacagcaggtgcagcccggggcctgggc
cacgaggagttgaagcagttgggcatcagcgccacagggcaccggaaacgcattctacgc
ctgctacagacaggcaccgaagagggctccctggatcccaaatcagatagtgccatggaa
ccatcccccagcccagccccgcaagcccagccccctaagcccgtgccgaagcccaggacc
gtgtttggtggactcagtggccctgccaccactcagagacctgggctgagcccagccctc
gggggaccaggagtgtccaggagcccagagcccagcccaaggcctcctcctctccccact
tcctcctctgagcagtcttcagccctaaatactgtggagatgatgcctaattccatctac
ttcggcctggactcaagaggcagggcacaggcagctcaggacaaggccccagacagctcc
caaatctctgcccccacccctgccctcaggcccacaacaggcacagtgcacatcatggat
cctggttgcctgtactatggtgtccaacctgtggggactccaggagcccccgacagaaga
gagagcagaggtgtttgtcagggcagggctgaacacaggctcagcagacaggatctggag
gcacgggaggatgctggctatgccagccttgagctacctggagactccaccctcttatcg
cccaccctggaaacagaggagaccagtgatgacctcatttcaccctatgccagcttctcc
ttcacggcagaccgcctcacgcccctgctcagtggctggctagacaagctctcccctcag
ggaaactatgtcttccagagacgctttgtgcagttcaatgggaggagtctgatgtacttt
ggcagtgacaaggaccccttccctaagggtgtgatacctttgactgccattgagatgacc
cgcagcagcaaggacaacaagttccaggtcatcaccggccagagggtgttcgtgttccgc
acagagagcgaggctcagcgggacatgtggtgctccacgctgcagtcctgtctgaaggag
cagcgcctcctgggccacccccggcccccccaaccaccccgacccctccgcacgggcatg
ctggagctgcgtggacacaaggccaaggtgtttgctgccttgagccctggagagctggca
ctgtacaagagtgagcaggccttctctctgggcatcgggatctgcttcatcgaactgcag
ggctgcagcgtccgggagaccaagagtcgaagctttgacctgctcacaccccatcgctgc
ttcagcttcacagccgagtctgggggtgctcggcagagctgggcggccgctctgcaggaa
gcagtaaccgagaccctgtctgactacgaggtggctgagaagatctggtctaatcgggcc
aaccggcagtgtgcggactgtgggtcctcccgcccagattgggctgctgtcaatttgggg
gtggtcatctgcaagcagtgtgcaggtcagcaccgggccctgggttctgggatctccaag
gtgcagagcctgaagctggacacgagtgtctggagtaatgagatagtacagttattcatt
gtcctgggaaatgatcgtgccaaccgcttctgggcagggaccctacccccaggtgaggga
ctacatccagatgcgacccctggcccccggggagagttcatctcccgaaagtaccgtctg
ggtctcttccggaagccccaccctcagtacccagatcatagccagcttctccaggcactg
tgtgcagctgtggcaagacccaacctgctgaagaacatgacccagctcctctgtgttgag
gcctttgaaggcgaggagccctggttccccccagcccctgatggcagctgccctggcctc
ttgccctcagacccctcccctggtgtgtacaatgaggtggtggtgcgtgctacttacagc
ggcttcctgtactgcagtcccgtcagcaacaaagctggaccctcaccccctcgcaggggc
cgggatgctcccccgcgcctttggtgtgtgctgggagcagctctggaaatgtttgcatcg
gaaaacagccctgaacccctcagcctcatacagccccaggatattgtatgtctgggtgtg
agccccccacccactgacccaggtgacaggttccccttttcctttgagctcatcctcgct
ggggggaggatccagcattttggcacagatggagctgacagtctggaggcctggactagt
gctgtgggcaagtggttctccccgctgagctgccaccagctgctgggccccgggctgctg
cggctgggccgcctatggctgcggtccccctcccatacagccccggcccctggtctctgg
ctgtcagggtttggcctccttcgtggtgaccacctcttcctgtgctcagcgccgggccca
ggccccccagcccctgaggacatggtgcatctgcggcggctacaggagatcagtgtggtt
tctgcagctgacaccccagataagaaagagcatttggtcctggtggagacaggaaggacc
ctgtatctgcaaggagagggccggctggacttcacggcatggaacgcagccattgggggc
gcggctggtgggggcggcacagggctgcaggagcagcagatgagccggggtgacatcccc
atcatcgtggatgcctgcatcagttttgttacccagcatgggctccggctggaaggtgta
taccggaaagggggcgctcgtgcccgcagcctgagactcctggctgagttccgtcgggat
gcccggtcggtgaagctccgaccaggggagcactttgtggaggatgtcactgacacactc
aaacgcttctttcgtgagctcgatgaccctgtgacctctgcacggttgctgcctcgctgg
agggaggctgctgagctgccccagaagaatcagcgcctggagaaatataaagatgtgatt
ggctgcctgccgcgggtcaaccgccgcacactggccaccctcattgggcatctctatcgg
gtgcagaaatgtgcggctctaaaccagatgtgcacgcggaacttggctctgctgtttgca
cccagcgtgttccagacggatgggcgaggggagcacgaggtgcgagtgctgcaagagctc
attgatggctacatctctgtctttgatatcgattctgaccaggtagctcagattgacttg
gaggtcagtcttatcaccacctggaaggacgtgcagctgtctcaggctggagacctcatc
atggaagtttatatagagcagcagctcccagacaactgtgtcaccctgaaggtgtcccca
accctgactgctgaggagctgactaaccaggtactggagatgcgggggacagcagctggg
atggacttgtgggtgacttttgagattcgcgagcatggggagctggagcggccactgcat
cccaaggaaaaggtcttagagcaggctttacaatggtgccagctcccagagccctgctca
gcttccctgctcttgaaaaaagtccccctggcccaagctggctgcctcttcacaggtatc
cgacgtgagagcccacgggtggggctgttgcggtgtcgtgaggagccacctcgcttgctg
ggaagccgcttccaggagaggttctttctgctgcgtggccgctgcctgctgctgctcaag
gagaagaaaagctctaaaccagaacgggagtggcctttggaaggtgccaaggtctacctg
ggaatccgcaagaagttaaagcccccaacaccgtggggcttcacattgatactagagaag
atgcacctctacttgtcctgcactgacgaggatgaaatgtgggattggaccaccagcatc
cttaaagcccagcacgatgaccagcagccagtggtcttacgacgccattcctcctctgac
cttgcccgtcagaagtttggcactatgcctttgctgcctatccgtggggatgacagtgga
gccaccctcctctctgccaatcagaccctgcggcgactacacaaccggaggaccctgtcc
atgttctttccaatgaagtcatcccaggggtctgtggaggagcaagaggagctggaggag
cctgtgtacgaggagccagtgtatgaggaagtaggggccttccctgagttgatccaggac
acttctacctccttctccaccacacgggagtggacagtgaagccagagaaccccctcacc
agccagaagtcattggatcaaccctttctctccaagtcaagcacccttggccaggaggag
aggccacctgagccccctccaggccccccttcaaagagcagtccccaggcacgggggtcc
ctagaggaacagctgctccaggagctcagcagcctcatcctgaggaaaggagagaccact
gcaggcctgggaagtccttcccagccatccagcccccaatcccccagccccactggcctt
ccaacacagacacctggcttccccacccaacccccatgcacttccagtccaccctccagc
cagcccctcacatga

KEGG   Homo sapiens (human): 64744Help
Entry
64744             CDS       T01001                                 

Gene name
SMAP2, SMAP1L
Definition
(RefSeq) small ArfGAP2
  KO
K12486  stromal membrane-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64744 (SMAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64744 (SMAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    64744 (SMAP2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    64744 (SMAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap
Motif
Other DBs
NCBI-GeneID: 64744
NCBI-ProteinID: NP_073570
OMIM: 616916
HGNC: 25082
Ensembl: ENSG00000084070
Vega: OTTHUMG00000007301
Pharos: Q8WU79(Tbio)
UniProt: Q8WU79
LinkDB All DBs
Structure
PDB: 

Position
1p34.2
AA seq 429 aa AA seqDB search
MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV
HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEK
KKYMDRSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKS
TAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGS
VPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSF
PGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQA
GYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAAN
QTLSPQMWK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaagtcggtgaaggacgtggatcggtaccaggctgtcctggccaacctgctg
ctggaggaggataacaagttttgtgcagattgccagtctaaagggccgcgatgggcctct
tggaacattggtgtgttcatctgcattcgatgtgctggaatccacaggaatctgggggtg
cacatatccagggtaaagtcagttaacctcgaccagtggactcaagaacagattcagtgc
atgcaagagatgggaaatggaaaggcaaaccgactttatgaagcctatcttcctgagacc
tttcggcgacctcagatagacccagctgttgaaggatttattcgagacaaatatgagaag
aagaaatacatggaccgaagtctggacatcaatgcctttaggaaagaaaaagatgacaag
tggaaaagagggagcgaaccagttccagaaaaaaaattggaacctgttgtttttgagaag
gtgaaaatgccacagaaaaaagaagacccacagctacctcggaaaagctccccgaaatcc
acagcgcctgtcatggatttgttgggccttgatgctcctgtggcctgctccattgcaaat
agtaagaccagcaataccctagagaaggatttagatctgttggcctctgttccatcccct
tcttcttccggttccagaaaggttgtaggttccatgccaactgcagggagtgccggctct
gttcctgaaaatctgaacctgtttccggagccagggagcaaatcagaagaaataggcaag
aaacagctctctaaagactccattctttcactgtatggatcccagacgcctcaaatgcct
actcaagcaatgttcatggctcccgctcagatggcatatcccacagcctaccccagcttc
cccggggttacacctcctaacagcataatggggagcatgatgcctccaccagtaggcatg
gttgctcagccaggagcttctgggatggttgcccccatggccatgcctgcaggctatatg
ggtggcatgcaggcatcaatgatgggtgtgccgaatggaatgatgaccacccagcaggct
ggctacatggcaggcatggcagctatgccccagactgtgtatggggtccagccagctcag
cagctgcaatggaaccttactcagatgacccagcagatggctgggatgaacttctatgga
gccaatggcatgatgaactatggacagtcaatgagtggcggaaatggacaggcagcaaat
cagactctcagtcctcagatgtggaaataa

KEGG   Homo sapiens (human): 84364Help
Entry
84364             CDS       T01001                                 

Gene name
ARFGAP2, IRZ, NBLA10535, ZFP289, ZNF289
Definition
(RefSeq) ADP ribosylation factor GTPase activating protein 2
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84364 (ARFGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84364 (ARFGAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    84364 (ARFGAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap
Motif
Other DBs
NCBI-GeneID: 84364
NCBI-ProteinID: NP_115765
OMIM: 606908
HGNC: 13504
Ensembl: ENSG00000149182
Vega: OTTHUMG00000166773
Pharos: Q8N6H7(Tbio)
UniProt: Q8N6H7
LinkDB All DBs
Structure
PDB: 

Position
11p11.2
AA seq 521 aa AA seqDB search
MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPAWDAPATEPSGTQQPAPS
TESSGLAQPEHGPNTDLLGTSPKASLELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSSQS
FSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKR
EQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKYKD
NPFSLGESFGSRWDTDAAWGMDRVEEKEPEVTISSIRPISERATNRREVESRSSGLESSE
ARQKFAGAKAISSDMFFGREVDAEYEARSRLQQLSGSSAISSSDLFGDMDGAHGAGSVSL
GNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagccgaacaagaccgaaatccagactctttttaagaggcttcgcgcagtt
ccaaccaacaaggcctgtttcgactgcggcgccaagaatccgagttgggccagcatcacg
tacggtgttttcttgtgcattgactgttccggggtgcaccgctccctgggcgtccatctg
agcttcatcaggtccacagagttggattccaactggaactggttccagctgaggtgtatg
caggtcggcgggaatgccaatgcgacggctttttttcgccaacatggatgcacagccaat
gatgccaacaccaaatataatagccgagctgcccagatgtaccgggagaagatccggcag
ctggggagtgcggccctggctaggcatggcactgatctttggatagacaacatgagtagt
gccgttcctaatcactccccagagaagaaggactctgatttcttcacagaacacactcaa
ccccctgcctgggatgcgccagccactgagccttcagggacccagcagccagccccgtct
acagagagcagtggcctggcacagccggagcatggccccaacacagacctgcttggcacc
tcacccaaagcctcactggaactgaaaagctccatcattggcaagaagaagccagcagca
gctaagaaagggctgggtgccaagaaaggcctaggggcccagaaggtgagcagccagagc
ttcagtgagattgagcggcaggctcaggtggcagagaagctccgtgagcagcaggcagcc
gatgccaagaagcaggcggaggagtccatggtcgcctccatgcgtctggcctaccaggag
ctccagattgatcgtaagaaagaggaaaagaagctacagaatctggaagggaagaagcga
gagcaggcagaaaggttgggcatgggcttggtatcccgaagctctgtctcccactccgtg
ctgtctgagatgcaggtgattgagcaggaaaccccagtgagtgcaaaatcctctcgctcg
cagctggacttgtttgacgatgttggtactttcgcctctggacccccaaagtacaaggac
aatcccttttccttaggggaaagctttggctcccgctgggatacagatgctgcctggggt
atggacagggtagaggagaaggagccagaagtgaccatctcaagcatccggcctatttca
gaaagagccacaaaccggagggaagtggagagccggagctcaggcctcgagtctagtgag
gcgcgtcagaaattcgcaggagccaaagccatctcatctgacatgttctttgggcgggag
gtggatgcggagtatgaggccaggtctcggctgcagcagctctcaggcagcagtgccatc
agctcttcagacctctttggggacatggatggagctcacggagcaggaagtgtatctctg
gggaacgtgctgcctacagcggacattgcccagtttaagcagggtgtcaagtctgtggct
gggaaaatggctgtgctggccaatggtgtgatgaattccttgcaggatcgctacggttcc
tactga

KEGG   Homo sapiens (human): 8853Help
Entry
8853              CDS       T01001                                 

Gene name
ASAP2, AMAP2, CENTB3, DDEF2, PAG3, PAP, Pap-alpha, SHAG1
Definition
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8853 (ASAP2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8853 (ASAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8853 (ASAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    8853 (ASAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_9 SH3_1 Ank SH3_2 Ank_5 Ank_4 BAR Ank_3 PH_9 PH_13
Motif
Other DBs
NCBI-GeneID: 8853
NCBI-ProteinID: NP_003878
OMIM: 603817
HGNC: 2721
Ensembl: ENSG00000151693
Vega: OTTHUMG00000117485
Pharos: O43150(Tbio)
UniProt: O43150
LinkDB All DBs
Position
2p25.1; 2p24
AA seq 1006 aa AA seqDB search
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
AKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRP
ISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPS
TTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST
PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNP
DELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgccggaccagatctccgtgtcggaattcgtggccgagacccatgaggactacaaggcg
cccacggcctccagcttcaccacccgcacggcgcagtgccggaacactgtggcggccatc
gaggaggctttggacgtggaccggatggttctttacaaaatgaagaaatccgtgaaagca
atcaacagctctgggctggctcacgtggaaaatgaagagcagtacacccaggctctggag
aagtttggcggcaactgtgtatgcagagatgacccagatttaggaagtgcgttcctgaag
ttctcagtgtttacaaaggagttgacagcacttttcaaaaacctgattcagaatatgaac
aacataatctccttccctttggacagtttgctgaagggggacctgaaaggagtgaaaggg
gatctgaaaaagccttttgataaagcttggaaggactatgaaacaaaaataaccaagata
gaaaaggagaaaaaggaacacgccaagctccatgggatgattcggactgaaataagcgga
gcggaaattgccgaagagatggaaaaggagaggcgcttcttccagctacagatgtgcgag
tatctgctgaaggtcaacgaaatcaagattaaaaagggagtagatttacttcagaatctg
atcaaatactttcatgcccaatgcaatttttttcaggatggactcaaagccgtggaaagc
ctcaaaccttccattgaaacgctgtctacggatcttcacacgatcaaacaggcccaggat
gaagaaagaaggcagttgatacagcttcgagatattttgaaatccgcattgcaggttgaa
cagaaagaggactcccaaattcgtcagagcacagcttatagcttacatcagcctcaggga
aacaaggaacatgggaccgagcggaacggcagcctctacaagaagagtgacgggatccga
aaagtgtggcagaaaaggaaatgttcagttaaaaatggttttctgaccatatcccatggt
accgctaaccggcctcctgcaaagctcaacctgctaacctgccaggtgaagaccaaccct
gaggagaagaagtgctttgacctcatttcacatgacagaacttaccactttcaagctgaa
gatgaacaggaatgtcaaatatggatgtctgtgctgcaaaatagcaaagaagaagcttta
aacaatgcatttaagggggatgacaatactggagaaaataacatcgtccaagaactgaca
aaggagatcatctcagaagtgcagaggatgacgggcaatgacgtctgctgtgactgtggg
gcgccagatcctacatggctttccaccaacctgggcatcctgacctgcatcgagtgttcc
ggaatccaccgagagctgggggttcattattccaggatgcagtccctgaccttagatgta
ctgggaacatctgagctgctgctcgccaagaatattgggaatgcaggctttaatgagatc
atggaatgttgcctaccagctgaggactcagtcaaacccaacccaggcagcgacatgaat
gcaagaaaggactacatcacagccaagtacatcgagaggagatacgcaaggaagaagcac
gcggataacgcggcgaagcttcacagtctttgcgaggccgtcaaaacgagagatattttt
ggattgctccaagcttatgctgatggtgtggatcttacggaaaaaatcccactggccaac
ggacatgagccggatgaaacggccctccaccttgcagtcagatccgtggatcgaacctct
cttcacattgtagactttttagttcagaacagtgggaacctggataaacagacagggaaa
ggcagcacagccctgcactactgctgcctgaccgacaatgccgagtgcctcaagttgctc
ctgcgggggaaggcctccatcgagatagcaaacgagtcaggagagactccgctggacatt
gccaagcgcctcaagcacgagcactgtgaggagctgctgacccaagccttatctggaaga
tttaattctcacgttcacgttgaatatgaatggcgactactccacgaagacctggatgaa
agtgatgacgacatggatgagaaattgcagcccagtcccaaccggcgggaagaccggccc
atcagcttctaccagctgggctccaaccagcttcagtctaacgctgtatctttggccaga
gatgctgcaaaccttgccaaggagaagcagagggctttcatgcccagcatcttgcagaat
gagacttacggagccctcctgagtggcagcccacctcccgcccagcctgcagcccccagc
accaccagcgcccccccgcttcctccacggaatgttggcaaagttcagacagcctcctct
gctaacaccctgtggaagacaaactctgtaagtgtggacggtggaagccggcagcgatct
tcgtcagatccgccagctgtccatccaccgctgccccctcttcgcgtgacatctaccaat
cccctgacccccacgccgcccccacccgttgccaagacgcccagcgtaatggaagccttg
agccagccgagcaagcctgccccgcctgggatctcacagatcaggcccccacctctgccc
ccacagccgcccagccgcctcccgcagaagaagcctgcgccgggggctgacaagtccacc
ccactgaccaacaaaggccaaccgagaggacctgtggatctctctgcaacggaagctctg
ggtcctctgtccaatgctatggtcctgcagccccctgcacccatgcctaggaagtcgcag
gcaaccaagttgaagcctaagcgggtgaaagcgctctataactgtgtggctgacaacccc
gatgagctcaccttctccgagggggatgtgatcatcgtggacggggaggaggaccaggag
tggtggattggccacattgatggagatcctggtcgcaaaggcgcattcccggtgtcattt
gtgcactttatcgctgactga

KEGG   Homo sapiens (human): 9744Help
Entry
9744              CDS       T01001                                 

Gene name
ACAP1, CENTB1
Definition
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9744 (ACAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9744 (ACAP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9744 (ACAP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9744 (ACAP1)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    9744 (ACAP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9744 (ACAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR_3 ArfGap PH Ank_5 Ank_2 Ank_4 Ank_3 PH_11
Motif
Other DBs
NCBI-GeneID: 9744
NCBI-ProteinID: NP_055531
OMIM: 607763
HGNC: 16467
Ensembl: ENSG00000072818
Vega: OTTHUMG00000102199
Pharos: Q15027(Tbio)
UniProt: Q15027
LinkDB All DBs
Structure
PDB: 

Position
17p13.1
AA seq 740 aa AA seqDB search
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFV
VGICDLARLGPPEPMMAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGF
REARRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVI
EDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQ
RHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIA
SAFSQARLDDSPRGPGQGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVI
INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQP
PVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNW
VNGGQDNATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFL
KRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaagctggatttcgaggagtgtctcaaggactcaccccgtttccgagcctct
attgagctggtggaagccgaagtgtcagaattggagacccgtctggaaaagctcctgaaa
ctgggcactggtctcctggaaagtgggcgccattaccttgctgccagccgcgccttcgtt
gtcggcatttgtgacctggcccgcctgggtccaccagagcccatgatggcggagtgtctg
gaaaaattcaccgtgagcctgaaccacaagctggacagccatgcggagcttctagatgcc
acccaacacacactgcagcagcagatccagaccctggtcaaggaaggtctgcggggtttc
cgagaggctcgccgggatttctggcggggggctgagagcctggaggctgccctgacccac
aacgcagaggttcccaggcgccgggcccaggaggcagaagaggcaggagctgctttgagg
acggctcgagctgggtaccggggacgggcactggattatgccctgcagatcaacgtgatt
gaggacaagaggaagtttgacatcatggagtttgtgctgcgtttggtggaggcccaggct
acccatttccagcagggccatgaggagctgagccggctgtcccagtatcgaaaggagctg
ggcgcccagttgcaccagctggtcttgaattcagcacgagagaagagggacatggagcag
agacacgtgctgctgaaacagaaggagctgggtggggaggagccagaaccaagcttaaga
gaggggcctggtggcctggtgatggaaggacatctcttcaaacgggccagcaacgcattt
aagacctggagcagacgctggttcaccattcagagcaaccaactggtttaccagaagaag
tacaaggaccctgtgactgtggtggtggatgaccttcgtctctgcacagtgaaactctgc
cctgactcagaaaggcggttctgctttgaggtggtgtccaccagcaagtcctgcctcctc
caggctgactcagagcgcctcctgcagctgtgggtcagtgctgtgcagagcagcattgct
tctgccttcagtcaggctcgccttgatgacagcccccggggtccaggccagggctcagga
cacctggccataggctctgctgccaccctgggctctggtggaatggccaggggaagggag
cctgggggagtcgggcacgtggtggcccaggtccagagtgtggatggcaatgcccagtgc
tgcgactgccgggagccagccccggagtgggccagcatcaaccttggtgtcaccctctgc
attcagtgttccggcatccacaggagccttggtgttcacttctccaaagtccggtctctg
acccttgactcatgggagccagaactagtgaagctcatgtgtgagctgggaaatgtcatc
atcaaccagatctatgaggcccgcgtggaggccatggcagtgaagaaaccagggcccagc
tgctcccggcaggagaaggaggcctggattcacgctaaatacgtggagaagaagttcctg
accaagctgcctgagattcgagggcgaagaggtggccgggggcgcccaagggggcagcct
cctgtgcccccaaagccttccatcaggccccggccagggagcttgagatccaagccagag
cccccctctgaggacctgggaagcctgcaccctggggccctactgtttcgagcgtctggg
catcctccatctcttcccaccatggctgatgcccttgcccatggagctgatgtcaactgg
gtcaatgggggccaagataatgccacaccgctgatccaggccacagctgctaattctctt
ctggcctgtgagtttctcctccagaacggggcgaacgtgaaccaagcggacagtgcgggc
cggggcccgctgcaccacgcaaccattcttggccacacggggctcgcctgcctgttcctg
aaacggggagctgatctgggggctcgagactctgaaggcagggaccctctgaccatcgcc
atggaaacagccaacgctgacatcgtcaccctgctacgactggcaaagatgagggaggct
gaagcggcccaggggcaggcaggagatgagacgtatcttgacatcttccgcgacttctcc
ctcatggcgtcagacgacccggagaagctgagccgtcgcagtcatgacctccacacgctg
tga

KEGG   Homo sapiens (human): 9815Help
Entry
9815              CDS       T01001                                 

Gene name
GIT2, CAT-2, CAT2, PKL
Definition
(RefSeq) GIT ArfGAP 2
  KO
K12487  G protein-coupled receptor kinase interactor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9815 (GIT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    9815 (GIT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9815 (GIT2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9815 (GIT2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9815 (GIT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GIT1_C ArfGap GIT_CC GIT_SHD Ank_2 Ank_5 Ank_4 Ank GAS Shugoshin_N Sen15 TTRAP DMPK_coil T7SS_ESX_EspC YabA
Motif
Other DBs
NCBI-GeneID: 9815
NCBI-ProteinID: NP_476510
OMIM: 608564
HGNC: 4273
Ensembl: ENSG00000139436
Vega: OTTHUMG00000169313
Pharos: Q14161(Tbio)
UniProt: Q14161
LinkDB All DBs
Position
12q24.11
AA seq 759 aa AA seqDB search
MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
SLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAT
TNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDME
PDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPG
DPGSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacggctccggagcagcgaggtgtgcgctgactgcagcgggccggatccttcc
tgggcatcagtaaataggggaacgtttttatgtgatgagtgctgcagtgtccatcggagt
ctagggcgccatatctcccaagtgaggcatctgaaacacacaccgtggcctccaacactg
cttcagatggttgagaccttgtataataacggtgctaactctatatgggagcattctttg
ctggaccctgcgtctattatgagtggaagacgtaaagctaatccacaggataaagtacat
cccaataaagcggaattcatcagagccaagtatcagatgttagcgttcgtccatcgcttg
ccctgccgggatgacgatagtgtgactgccaaagatcttagcaagcaactccattcgagc
gtgagaacagggaatcttgaaacctgtttgagactgttatctttaggagcacaagccaac
ttctttcatcctgaaaaaggaaacaccccactccatgttgcctccaaagcagggcagatt
ttacaggctgaattattggcagtatatggagcagacccaggcacacaggattctagtggg
aaaactcccgttgattatgcaaggcaaggagggcaccatgagctggcagagcgcctcgtg
gaaatacagtatgagctaacggacagactagccttctatctctgtggcaggaaaccagat
cacaaaaatggacagcactttataatacctcaaatggcagacagcagcctggatttgtct
gaattggcaaaagctgctaagaagaaacttcaatctctaagtaatcatttgtttgaagaa
cttgccatggatgtgtacgatgaagttgacaggcgagagacggatgcagtctggcttgcc
acgcaaaaccacagcgccctggtaaccgagacaacggtcgtcccctttcttccggtcaat
cctgagtactcatcaacacgaaatcagggcagacagaagttagctcggttcaacgcccat
gagtttgccacgctggtcattgacattctcagtgacgccaagaggagacagcagggcagt
tctctctcgggttcaaaagacaatgtggagctcatactgaaaaccatcaataaccagcac
agcgttgagagtcaagacaacgatcagcccgactatgacagcgtggcatcagacgaagac
acagatttggaaaccactgcaagcaaaacaaaccggcagaagagcctagattcagattta
tcagatggaccagtcactgtacaggaatttatggaggtcaaaaacgctctagtggcttct
gaggccaagatacagcagctaatgaaggtgaataacaacttgagtgacgagctgagaatt
atgcagaaaaagcttcaaacactccagagtgaaaattcgaacctcaggaaacaggccaca
accaatgtatatcaggtgcaaactggttctgagtacacagacacttccaaccactcttcc
ttaaagagacgtccgtctgcccggggcagtaggcccatgtccatgtacgagaccggatca
ggtcagaaaccatatctcccaatgggagaagcgagccgccccgaagagagcaggatgaga
ctccagcccttccccgcgcacatcgggaggagtgcacttgtgacctcctcttcatctctg
ccttccttcccctccacactttcctggtcgagggacgaaagcgcccgaagggcatccagg
ctggagaagcagaacagcacacctgagagtgactacgacaacactcccaacgacatggag
ccagatggcatggggtcaagccgaaagggacggcaaagaagtatggtgtggccaggggat
ggcttggtaccagacacagcagaaccccatgtggccccaagccccactctccctagcacc
gaagatgtcatcaggaagactgaacagatcaccaaaaacatacaggagctcttaagagca
gcccaagaaaataaacatgacagttatattccctgctcagagaggatacacgtagctgtt
acagaaatggcagcattattccccaaaaaacccaagtctgatatggtgaggacttccctt
cgtttactgacgtccagtgcctaccgactgcagtcagagtgcaagaagaccctcccaggg
gaccccggctcacccacagacgttcagctggtcacgcagcaggtcatccagtgtgcgtac
gacatcgccaaggctgccaagcagctggttaccatcaccaccaaagagaacaacaactga

DBGET integrated database retrieval system