KEGG   Homo sapiens (human): 116986Help
Entry
116986            CDS       T01001                                 

Gene name
AGAP2, CENTG1, GGAP2, PIKE
Definition
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
  KO
K17848  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    116986 (AGAP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116986 (AGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116986 (AGAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    116986 (AGAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap Ras PH Ank_2 Ank Ank_5 Ank_4 PH_6 Roc Ank_3 Spore_IV_A
Motif
Other DBs
NCBI-GeneID: 116986
NCBI-ProteinID: NP_001116244
OMIM: 605476
HGNC: 16921
Ensembl: ENSG00000135439
Vega: OTTHUMG00000170285
Pharos: Q99490(Tbio)
UniProt: Q99490 F8VVT9
LinkDB All DBs
Structure
PDB: 

Position
12q14.1
AA seq 1192 aa AA seqDB search
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAAGAAGARGSETGDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGTGGAEPPALSPAPASPARPVSPAPGRRLSLWAVPPG
PPLSGGLSPDPKPGGAPTSSRRPLLSSPSWGGPEPEGRAGGGIPGSSSPHPGTGSRRLKV
APPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATA
AAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPS
PATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPP
GSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFS
LEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMK
RCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEK
RSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHS
THGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSP
SPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDA
WVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLN
LGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAK
PSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHG
PLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCA
DILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgagccggggcgcgggcgcgcttcagcgccggacaacgacctacctcatctcgctgacc
ctggttaagctcgagtcggtgcctccgccgccgccttctccgtctgcggccgcggccggc
gccgccggtgccagaggctccgagactggggatcctggcagcccccgaggcgcggaggag
ccgggcaagaagcggcacgaacgtctcttccaccggcaggatgcgctgtggatcagcacg
agcagcgcgggcaccgggggcgcggagcccccagccctgtccccggctccggccagtccg
gcccgcccagtctcccccgctcccggccgccgcctctccctctgggccgtccctccggga
cccccgctctccgggggactgagccccgaccccaagcctgggggcgcccccacctcctcc
cggcgccccctgctcagcagcccgagctggggcggcccggagcccgaaggccgggcgggc
ggcggcatccctggctcatcctctccgcaccctggcaccggcagccggaggctcaaggtg
gcgcctcctccgccggctcccaagccttgcaagaccgtgaccacgagtggagccaaagcc
ggcgggggcaagggcgcgggtagccgcctgtcatggcccgaaagcgagggcaagcccagg
gtcaaggggtcaaagagcagcgccgggactggagcttcggtctctgccgccgccaccgcc
gccgccgccgggggagggggctctacagcttcgacctctggtggggtcggggctggggct
ggagcccgagggaagttgtcccctcggaaaggcaagagtaagaccttggacaacagtgac
ttgcatccgggaccgcctgccggctctcctcctccgctaaccctcccaccaactccgagt
ccagccactgctgtcaccgctgcttccgcgcagccccccgggcctgcacctccaatcact
ctggagcctccagctccggggctgaaacggggccgggaggggggccgagcatccactcgt
gaccgcaagatgctcaagtttatcagcggcatcttcaccaagagcacaggagggcctcct
ggctccgggccccttcccggaccccccagcctgtcttctggcagcgggtccagggagctg
ctgggcgccgagctccgcgcttcccctaaggctgtgatcaatagccaggaatggactttg
agccgctccattcctgaactgcgcctgggtgtgctgggcgatgccaggagtgggaagtca
tcgctcatccaccgattcctgactggctcataccaggtgctggagaagacagagagtgag
cagtacaagaaagaaatgttggtggatggacagacacatctggtgctaatccgagaggaa
gctggggcacctgatgccaagttctcaggctgggcagatgctgtgatcttcgtcttcagc
ctggaggatgagaacagtttccaggctgtgagccgtctccatgggcagctgagttccctt
cgcggggagggacgaggaggcctggccttggcactggtggggacacaagacaggatcagt
gcttcctcccctcgggtggtgggagatgctcgtgccagagctctgtgcgcggacatgaaa
cgctgcagctactatgagacttgtgcaacctatgggctcaatgtggatcgggtcttccag
gaggtggcccagaaggtggtgaccttgcgcaagcagcaacagcttctggctgcctgcaag
tccctgcccagctccccaagccactcagctgcatccactccggtagctggccaggctagt
aacgggggccacactagcgactactcttcttccctcccgtcctcaccgaatgttggtcac
cgggagctccgagccgaggcagctgcagtggctggattgagcaccccagggtccctgcac
cgggcagccaagcgcaggaccagcctttttgcgaatcgtcggggtagtgactccgagaaa
cgaagcttggatagtcggggagagacaacagggagtgggcgagccatccccatcaaacag
agcttcctactaaaacgaagtggcaattccttgaacaaagaatggaagaagaaatatgta
accctgtccagtaatggctttctactctaccaccccagtattaacgattacatccacagt
acccacggcaaggagatggacttgctgcgaacaacagtcaaagtcccgggcaagcggccc
ccgagggccatctctgcctttggcccctcagccagcattaacgggctcgtcaaggacatg
agcactgtccagatgggtgaaggcctggaagccactactcccatgccaagccctagcccc
agccccagttccctgcagccaccaccagatcagacatccaaacacctgctgaagccagac
cggaatttggcccgagccctcagcacggactgtaccccatctggagacctgagccccctg
agtcgggaaccccctccttctcccatggtgaagaagcagaggaggaaaaaattgacaaca
ccatccaagactgaaggctcggctgggcaggctgaagccaagcgcaaaatgtggaaacta
aaatcctttggtagtttaagaaatatttataaagcagaggaaaactttgagttcctgatc
gtgtccagcacgggtcagacgtggcactttgaggcagccagttttgaggagcgggatgcc
tgggtccaggccatcgagagtcagatcctagccagtctgcaatgctgtgagagcagcaag
gtcaagctgcgcacagacagccaaagcgaggccgtggccatccaggcgatccggaacgcc
aaggggaattcaatctgcgtggactgcggggcccccaaccccacgtgggccagcttgaac
ctgggcgccctcatctgcatcgagtgttctggcatccaccgcaacctgggcacacacctg
tcccgcgttcgctcgctggacttggacgactggccacgggagctgaccctggtgctgacg
gctattggcaacgacacggccaaccgcgtgtgggaaagcgacacgcgaggccgtgccaag
ccctcgcgggactcttcgcgggaggagcgcgagtcgtggattcgcgccaagtacgagcag
ctactgttcctggcgccgctgagcacctcggaggagccgctgggccgccagctgtgggcc
gccgtgcaggcccaggacgtggctaccgttctcctgcttttggcccatgcgcgacacggg
ccgctcgacaccagcgtagaggacccacagctgcgctccccactccacctggcggccgag
ctcgcccacgtcgtcatcacgcaactgctgctgtggtacggcgcggacgtggcggcccgt
gacgcccagggccgcacggcgctgttctacgcccgccaggctggaagccagctgtgcgcc
gacatccttctccagcacggctgcccgggtgagggcggcagcgcggccaccacgcccagc
gcggccaccacgcccagcatcaccgccacgcccagcccccgccgccggagcagcgccgct
agcgtgggccgcgccgacgccccggttgcgctggtatag

DBGET integrated database retrieval system