KEGG   Homo sapiens (human): 117Help
Entry
117               CDS       T01001                                 

Gene name
ADCYAP1R1, PAC1, PAC1R, PACAPR, PACAPRI
Definition
(RefSeq) ADCYAP receptor type I
  KO
K04587  pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04911  Insulin secretion
hsa04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    117 (ADCYAP1R1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    117 (ADCYAP1R1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    117 (ADCYAP1R1)
   04924 Renin secretion
    117 (ADCYAP1R1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    117 (ADCYAP1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    117 (ADCYAP1R1)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    117 (ADCYAP1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM Insulin_TMD Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 117
NCBI-ProteinID: NP_001109
OMIM: 102981
HGNC: 242
Ensembl: ENSG00000078549
Vega: OTTHUMG00000023884
Pharos: P41586(Tchem)
UniProt: P41586 A0A090N8F8
LinkDB All DBs
Structure
PDB: 

Position
7p14.3
AA seq 468 aa AA seqDB search
MAGVVHVSLAALLLLPMAPAMHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDN
ITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
DGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRK
LHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSN
YFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMN
DSTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIP
LFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKV
NRYFAVDFKHRHPSLASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgtcgtgcacgtttccctggctgctctcctcctgctgcctatggcccctgcc
atgcattctgactgcatcttcaagaaggagcaagccatgtgcctggagaagatccagagg
gccaatgagctgatgggcttcaatgattcctctccaggctgtcctgggatgtgggacaac
atcacgtgttggaagcccgcccatgtgggtgagatggtcctggtcagctgccctgagctc
ttccgaatcttcaacccagaccaagtctgggagaccgaaaccattggagagtctgatttt
ggtgacagtaactccttagatctctcagacatgggagtggtgagccggaactgcacggag
gatggctggtcggaacccttccctcattactttgatgcctgtgggtttgatgaatatgaa
tctgagactggggaccaggattattactacctgtcagtgaaggccctctacacggttggc
tacagcacatccctcgtcaccctcaccactgccatggtcatcctttgtcgcttccggaag
ctgcactgcacacgcaacttcatccacatgaacctgtttgtgtcgttcatgctgagggcg
atctccgtcttcatcaaagactggattctgtatgcggagcaggacagcaaccactgcttc
atctccactgtggaatgtaaggccgtcatggttttcttccactactgtgttgtgtccaac
tacttctggctgttcatcgagggcctgtacctcttcactctgctggtggagaccttcttc
cctgaaaggagatacttctactggtacaccatcattggctgggggaccccaactgtgtgt
gtgacagtgtgggctacgctgagactctactttgatgacacaggctgctgggatatgaat
gacagcacagctctgtggtgggtgatcaaaggccctgtggttggctctatcatggttaac
tttgtgctttttattggcattatcgtcatccttgtgcagaaacttcagtctccagacatg
ggaggcaatgagtccagcatctacttgcgactggcccggtccaccctgctgctcatccca
ctattcggaatccactacacagtatttgccttctccccagagaatgtcagcaaaagggaa
agactcgtgtttgagctggggctgggctccttccagggctttgtggtggctgttctctac
tgttttctgaatggtgaggtacaagcggagatcaagcgaaaatggcgaagctggaaggtg
aaccgttacttcgctgtggacttcaagcaccgacacccgtctctggccagcagtggggtg
aatgggggcacccagctctccatcctgagcaagagcagctcccaaatccgcatgtctggc
ctccctgctgacaatctggccacctga

KEGG   Homo sapiens (human): 135Help
Entry
135               CDS       T01001                                 

Gene name
ADORA2A, A2aR, ADORA2, RDC8
Definition
(RefSeq) adenosine A2a receptor
  KO
K04266  adenosine receptor A2a
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa05012  Parkinson disease
hsa05034  Alcoholism
Drug target
Adenosine (DG00243): D00045 D02300 D02769 D08646 D08647
Apadenoson: D03212
Binodenoson: D03120
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Ciforadenant: D11547
Doxofylline: D03898
Enprofylline: D04006
Evodenoson: D10362
Istradefylline: D04641
Preladenant: D09717
Proxyphylline: D01771
Regadenoson: D05711
Sonedenoson: D09003
Tozadenant: D10174
Vipadenant: D09991
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    135 (ADORA2A)
   04020 Calcium signaling pathway
    135 (ADORA2A)
   04024 cAMP signaling pathway
    135 (ADORA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    135 (ADORA2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    135 (ADORA2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    135 (ADORA2A)
  09165 Substance dependence
   05034 Alcoholism
    135 (ADORA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    135 (ADORA2A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    135 (ADORA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C Ni_hydr_CYTB
Motif
Other DBs
NCBI-GeneID: 135
NCBI-ProteinID: NP_000666
OMIM: 102776
HGNC: 263
Ensembl: ENSG00000128271
Vega: OTTHUMG00000150761
Pharos: P29274(Tclin)
UniProt: P29274 B3KVQ4 X5DNB4
LinkDB All DBs
Structure
PDB: 

Position
22q11.23
AA seq 412 aa AA seqDB search
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcatgggctcctcggtgtacatcacggtggagctggccattgctgtgctggcc
atcctgggcaatgtgctggtgtgctgggccgtgtggctcaacagcaacctgcagaacgtc
accaactactttgtggtgtcactggcggcggccgacatcgcagtgggtgtgctcgccatc
ccctttgccatcaccatcagcaccgggttctgcgctgcctgccacggctgcctcttcatt
gcctgcttcgtcctggtcctcacgcagagctccatcttcagtctcctggccatcgccatt
gaccgctacattgccatccgcatcccgctccggtacaatggcttggtgaccggcacgagg
gctaagggcatcattgccatctgctgggtgctgtcgtttgccatcggcctgactcccatg
ctaggttggaacaactgcggtcagccaaaggagggcaagaaccactcccagggctgcggg
gagggccaagtggcctgtctctttgaggatgtggtccccatgaactacatggtgtacttc
aacttctttgcctgtgtgctggtgcccctgctgctcatgctgggtgtctatttgcggatc
ttcctggcggcgcgacgacagctgaagcagatggagagccagcctctgccgggggagcgg
gcacggtccacactgcagaaggaggtccatgctgccaagtcactggccatcattgtgggg
ctctttgccctctgctggctgcccctacacatcatcaactgcttcactttcttctgcccc
gactgcagccacgcccctctctggctcatgtacctggccatcgtcctctcccacaccaat
tcggttgtgaatcccttcatctacgcctaccgtatccgcgagttccgccagaccttccgc
aagatcattcgcagccacgtcctgaggcagcaagaacctttcaaggcagctggcaccagt
gcccgggtcttggcagctcatggcagtgacggagagcaggtcagcctccgtctcaacggc
cacccgccaggagtgtgggccaacggcagtgctccccaccctgagcggaggcccaatggc
tatgccctggggctggtgagtggagggagtgcccaagagtcccaggggaacacgggcctc
ccagacgtggagctccttagccatgagctcaagggagtgtgcccagagccccctggccta
gatgaccccctggcccaggatggagcaggagtgtcctga

KEGG   Homo sapiens (human): 139760Help
Entry
139760            CDS       T01001                                 

Gene name
GPR119, GPCR2
Definition
(RefSeq) G protein-coupled receptor 119
  KO
K08424  glucose-dependent insulinotropic receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    139760 (GPR119)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    139760 (GPR119)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    139760 (GPR119)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Oleoylethanolamide
    139760 (GPR119)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 139760
NCBI-ProteinID: NP_848566
OMIM: 300513
HGNC: 19060
Ensembl: ENSG00000147262
Vega: OTTHUMG00000022397
Pharos: Q8TDV5(Tchem)
UniProt: Q8TDV5
LinkDB All DBs
Position
Xq26.1
AA seq 335 aa AA seqDB search
MESSFSFGVILAVLASLIIATNTLVAVAVLLLIHKNDGVSLCFTLNLAVADTLIGVAISG
LLTDQLSSPSRPTQKTLCSLRMAFVTSSAAASVLTVMLITFDRYLAIKQPFRYLKIMSGF
VAGACIAGLWLVSYLIGFLPLGIPMFQQTAYKGQCSFFAVFHPHFVLTLSCVGFFPAMLL
FVFFYCDMLKIASMHSQQIRKMEHAGAMAGGYRSPRTPSDFKALRTVSVLIGSFALSWTP
FLITGIVQVACQECHLYLVLERYLWLLGVGNSLLNPLIYAYWQKEVRLQLYHMALGVKKV
LTSFLLFLSARNCGPERPRESSCHIVTISSSEFDG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggaatcatctttctcatttggagtgatccttgctgtcctggcctccctcatcattgct
actaacacactagtggctgtggctgtgctgctgttgatccacaagaatgatggtgtcagt
ctctgcttcaccttgaatctggctgtggctgacaccttgattggtgtggccatctctggc
ctactcacagaccagctctccagcccttctcggcccacacagaagaccctgtgcagcctg
cggatggcatttgtcacttcctccgcagctgcctctgtcctcacggtcatgctgatcacc
tttgacaggtaccttgccatcaagcagcccttccgctacttgaagatcatgagtgggttc
gtggccggggcctgcattgccgggctgtggttagtgtcttacctcattggcttcctccca
ctcggaatccccatgttccagcagactgcctacaaagggcagtgcagcttctttgctgta
tttcaccctcacttcgtgctgaccctctcctgcgttggcttcttcccagccatgctcctc
tttgtcttcttctactgcgacatgctcaagattgcctccatgcacagccagcagattcga
aagatggaacatgcaggagccatggctggaggttatcgatccccacggactcccagcgac
ttcaaagctctccgtactgtgtctgttctcattgggagctttgctctatcctggaccccc
ttccttatcactggcattgtgcaggtggcctgccaggagtgtcacctctacctagtgctg
gaacggtacctgtggctgctcggcgtgggcaactccctgctcaacccactcatctatgcc
tattggcagaaggaggtgcgactgcagctctaccacatggccctaggagtgaagaaggtg
ctcacctcattcctcctctttctctcggccaggaattgtggcccagagaggcccagggaa
agttcctgtcacatcgtcactatctccagctcagagtttgatggctaa

KEGG   Homo sapiens (human): 153Help
Entry
153               CDS       T01001                                 

Gene name
ADRB1, ADRB1R, B1AR, BETA1AR, RHR
Definition
(RefSeq) adrenoceptor beta 1
  KO
K04141  adrenergic receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04540  Gap junction
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04970  Salivary secretion
hsa05414  Dilated cardiomyopathy (DCM)
Drug target
Acebutolol (DG00314): D00597 D02338
Adaprolol maleate: D02765
Alprenolol (DG00303): D01182 D07156
Alprenoxime hydrochloride: D02834
Amiodarone (DG00204): D00636 D02910
Amosulalol (DG01302): D01469 D07451
Arbutamine: D02976
Arotinolol (DG01303): D01830 D07465
Atenolol: D00235
Befunolol (DG01138): D01512 D07496
Beradilol monoethyl maleate: D09843
Betaxolol (DG00315): D00598 D07526
Bevantolol: D01369
Bisoprolol (DG00316): D00634 D02342
Bopindolol (DG00310): D01794 D07537
Bucumolol hydrochloride: D01492
Bufetolol hydrochloride: D01504
Bunitrolol hydrochloride: D01444
Bunolol hydrochloride: D03177
Bupranolol (DG00311): D01454 D07590
Butopamine: D03195
Carteolol (DG00308): D00599 D07624
Carvedilol (DG00321): D00255 D03415
Celiprolol (DG00317): D01741 D07660
Cetamolol hydrochloride: D03449
Cicloprolol hydrochloride: D03490
Cimaterol: D03502
Cloranolol: D07183
Denopamine: D02614
Dexpropranolol hydrochloride: D03729
Diacetolol hydrochloride: D03759
Dilevalol hydrochloride: D01906
Dipivefrine (DG01129): D01017 D02349
Dobutamine (DG00216): D00632 D03879 D03880 D03881
Docarpamine: D01903
Dronedarone (DG00207): D02537 D03914
Droxidopa: D01277
Epanolol: D06646
Ephedrine (DG00227): D00124 D01386 D04018
Epinephrine (DG00013): D00095 D00996 D02149
Epinephryl borate: D04026
Esmolol (DG00318): D00644 D07916
Etilefrine (DG00210): D01573 D07931
Exaprolol hydrochloride: D04120
Flestolol sulfate: D04190
Indenolol (DG01323): D01958 D08078
Isoprenaline (DG00211): D01390 D02066 D02150 D08090
Labetalol (DG00320): D00600 D08106
Landiolol: D01847
Levdobutamine lactobionate: D04708
Levobetaxolol hydrochloride: D04710
Levobunolol (DG01136): D01025 D08115
Medroxalol (DG01317): D04888 D04889
Mepindolol: D07181
Methylephedrine (DG01229): D01952 D02109 D08206 D09842
Metipranolol (DG01137): D02081 D02374
Metoprolol (DG00313): D00601 D00635 D02358 D05011
Nadolol: D00432
Nebivolol (DG00319): D05127 D06622
Nipradilol: D01691
Norepinephrine (DG00212): D00076 D05206 D08284 D09794
Octodrine: D05228
Oxprenolol (DG00304): D01806 D08318
Pamatolol sulfate: D05345
Penbutolol (DG00312): D00602 D08074
Phenylpropanolamine (DG01041): D01224 D05466 D08368
Pindolol: D00513
Practolol: D05587
Primidolol: D02389
Propranolol (DG00305): D00483 D08443
Pseudoephedrine (DG01042): D00485 D05648 D05649 D08449
Racephedrine Hydrochloride: D08982
Racepinephrine (DG01444): D05688 D05689
S-atenolol: D01471
Sotalol (DG00307): D01026 D08525
Talinolol: D07184
Tazolol hydrochloride: D06014
Tertatolol (DG00309): D07182 D08572
Tilisolol (DG01322): D01795 D08598
Timolol (DG00306): D00378 D00603 D08600
Tiprenolol hydrochloride: D06162
Tolamolol: D06176
Xamoterol (DG00231): D06328 D06329
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    153 (ADRB1)
   04024 cAMP signaling pathway
    153 (ADRB1)
   04022 cGMP-PKG signaling pathway
    153 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    153 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    153 (ADRB1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    153 (ADRB1)
   04924 Renin secretion
    153 (ADRB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    153 (ADRB1)
  09154 Digestive system
   04970 Salivary secretion
    153 (ADRB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    153 (ADRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    153 (ADRB1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    153 (ADRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 153
NCBI-ProteinID: NP_000675
OMIM: 109630
HGNC: 285
Ensembl: ENSG00000043591
Vega: OTTHUMG00000019079
Pharos: P08588(Tclin)
UniProt: P08588
LinkDB All DBs
Position
10q25.3
AA seq 477 aa AA seqDB search
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQGLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgggggtgctcgtcctgggcgcctccgagcccggtaacctgtcgtcggccgca
ccgctccccgacggcgcggccaccgcggcgcggctgctggtgcccgcgtcgccgcccgcc
tcgttgctgcctcccgccagcgaaagccccgagccgctgtctcagcagtggacagcgggc
atgggtctgctgatggcgctcatcgtgctgctcatcgtggcgggcaatgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctgtggacctcagtggacgtgctg
tgcgtgacggccagcatcgagaccctgtgtgtcattgccctggaccgctacctcgccatc
acctcgcccttccgctaccagagcctgctgacgcgcgcgcgggcgcggggcctcgtgtgc
accgtgtgggccatctcggccctggtgtccttcctgcccatcctcatgcactggtggcgg
gcggagagcgacgaggcgcgccgctgctacaacgaccccaagtgctgcgacttcgtcacc
aaccgggcctacgccatcgcctcgtccgtagtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgtttcctcggcggcccagcgcggccgccctcgccctcgccctcgcccgtc
cccgcgcccgcgccgccgcccggacccccgcgccccgccgccgccgccgccaccgccccg
ctggccaacgggcgtgcgggtaagcggcggccctcgcgcctcgtggccctgcgcgagcag
aaggcgctcaagacgctgggcatcatcatgggcgtcttcacgctctgctggctgcccttc
ttcctggccaacgtggtgaaggccttccaccgcgagctggtgcccgaccgcctcttcgtc
ttcttcaactggctgggctacgccaactcggccttcaaccccatcatctactgccgcagc
cccgacttccgcaaggccttccagggactgctctgctgcgcgcgcagggctgcccgccgg
cgccacgcgacccacggagaccggccgcgcgcctcgggctgtctggcccggcccggaccc
ccgccatcgcccggggccgcctcggacgacgacgacgacgatgtcgtcggggccacgccg
cccgcgcgcctgctggagccctgggccggctgcaacggcggggcggcggcggacagcgac
tcgagcctggacgagccgtgccgccccggcttcgcctcggaatccaaggtgtag

KEGG   Homo sapiens (human): 1812Help
Entry
1812              CDS       T01001                                 

Gene name
DRD1, DADR, DRD1A
Definition
(RefSeq) dopamine receptor D1
  KO
K04144  dopamine receptor D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
Network
nt06124  Chemokine signaling (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00410  DRD1-GNAS-AC-PKA signaling pathway
Drug target
Acepromazine (DG00870): D02604 D07065
Acetophenazine (DG00878): D00788
Adrogolide hydrochloride: D02775
Apomorphine (DG00486): D02004 D07460
Butaclamol hydrochloride: D02641
Carphenazine maleate: D02644
Chlorprothixene (DG00894): D00790 D02162 D07686 D07687
Ciladopa hydrochloride: D03494
Clopenthixol: D02613
Dexpramipexole (DG01331): D09886 D09887
Docarpamine: D01903
Dopamine (DG00213): D00633 D07870
Dopexamine (DG00222): D03891 D03892
Ecopipam hydrochloride: D03937
Etilevodopa: D04097
Fenoldopam (DG00226): D00613 D07946
Flupentixol (DG00893): D01044 D02236 D07976
Ibopamine (DG00223): D04488 D08057
Levodopa: D00059
Oxiperomide: D02676
Pergolide (DG00861): D00502 D08339
Pipotiazine (DG00884): D02680 D08385
Tavapadon: D11431
Tiotixene (DG00895): D00374 D02612
Zicronapine (DG01539): D10329 D10495
Zuclopenthixol (DG00896): D03556 D08691 D08692 D08693
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1812 (DRD1)
   04024 cAMP signaling pathway
    1812 (DRD1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1812 (DRD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1812 (DRD1)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1812 (DRD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    1812 (DRD1)
  09165 Substance dependence
   05030 Cocaine addiction
    1812 (DRD1)
   05031 Amphetamine addiction
    1812 (DRD1)
   05032 Morphine addiction
    1812 (DRD1)
   05034 Alcoholism
    1812 (DRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1812 (DRD1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1812 (DRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 1812
NCBI-ProteinID: NP_000785
OMIM: 126449
HGNC: 3020
Ensembl: ENSG00000184845
Vega: OTTHUMG00000130557
Pharos: P21728(Tclin)
UniProt: P21728
LinkDB All DBs
Position
5q35.2
AA seq 446 aa AA seqDB search
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggactctgaacacctctgccatggacgggactgggctggtggtggagagggacttc
tctgttcgtatcctcactgcctgtttcctgtcgctgctcatcctgtccacgctcctgggg
aacacgctggtctgtgctgccgttatcaggttccgacacctgcggtccaaggtgaccaac
ttctttgtcatctccttggctgtgtcagatctcttggtggccgtcctggtcatgccctgg
aaggcagtggctgagattgctggcttctggccctttgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccactgcatccatcctcaacctctgtgtgatcagcgtggac
aggtattgggctatctccagccctttccggtatgagagaaagatgacccccaaggcagcc
ttcatcctgatcagtgtggcatggaccttgtctgtactcatctccttcatcccagtgcag
ctcagctggcacaaggcaaaacccacaagcccctctgatggaaatgccacttccctggct
gagaccatagacaactgtgactccagcctcagcaggacatatgccatctcatcctctgta
ataagcttttacatccctgtggccatcatgattgtcacctacaccaggatctacaggatt
gctcagaaacaaatacggcgcattgcggccttggagagggcagcagtccacgccaagaat
tgccagaccaccacaggtaatggaaagcctgtcgaatgttctcaaccggaaagttctttt
aagatgtccttcaaaagagaaactaaagtcctgaagactctgtcggtgatcatgggtgtg
tttgtgtgctgttggctacctttcttcatcttgaactgcattttgcccttctgtgggtct
ggggagacgcagcccttctgcattgattccaacacctttgacgtgtttgtgtggtttggg
tgggctaattcatccttgaaccccatcatttatgcctttaatgctgattttcggaaggca
ttttcaaccctcttaggatgctacagactttgccctgcgacgaataatgccatagagacg
gtgagtatcaataacaatggggccgcgatgttttccagccatcatgagccacgaggctcc
atctccaaggagtgcaatctggtttacctgatcccacatgctgtgggctcctctgaggac
ctgaaaaaggaggaggcagctggcatcgccagacccttggagaagctgtccccagcccta
tcagtcatattggactatgacactgacgtctctctggagaagatccaacccatcacacaa
aacggtcagcacccaacctga

KEGG   Homo sapiens (human): 1816Help
Entry
1816              CDS       T01001                                 

Gene name
DRD5, DBDR, DRD1B, DRD1L2
Definition
(RefSeq) dopamine receptor D5
  KO
K05840  dopamine receptor D5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04728  Dopaminergic synapse
Disease
H01895  Attention deficit hyperactivity disorder (ADHD)
Drug target
Dexpramipexole (DG01331): D09886 D09887
Dopamine (DG00213): D00633 D07870
Dopexamine (DG00222): D03891 D03892
Ecopipam hydrochloride: D03937
Etilevodopa: D04097
Levodopa: D00059
Oxiperomide: D02676
Tavapadon: D11431
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1816 (DRD5)
   04024 cAMP signaling pathway
    1816 (DRD5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1816 (DRD5)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1816 (DRD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1816 (DRD5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    1816 (DRD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 1816
NCBI-ProteinID: NP_000789
OMIM: 126453
HGNC: 3026
Ensembl: ENSG00000169676
Vega: OTTHUMG00000128489
Pharos: P21918(Tchem)
UniProt: P21918
LinkDB All DBs
Position
4p16.1
AA seq 477 aa AA seqDB search
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgccaggcagcaacggcaccgcgtacccggggcagttcgctctataccagcag
ctggcgcaggggaacgccgtggggggctcggcgggggcaccgccactggggccctcacag
gtggtcaccgcctgcctgctgaccctactcatcatctggaccctgctgggcaacgtgctg
gtgtgcgcagccatcgtgcggagccgccacctgcgcgccaacatgaccaacgtcttcatc
gtgtctctggccgtgtcagaccttttcgtggcgctgctggtcatgccctggaaggcagtc
gccgaggtggccggttactggccctttggagcgttctgcgacgtctgggtggccttcgac
atcatgtgctccactgcctccatcctgaacctgtgcgtcatcagcgtggaccgctactgg
gccatctccaggcccttccgctacaagcgcaagatgactcagcgcatggccttggtcatg
gtcggcctggcatggaccttgtccatcctcatctccttcattccggtccagctcaactgg
cacagggaccaggcggcctcttggggcgggctggacctgccaaacaacctggccaactgg
acgccctgggaggaggacttttgggagcccgacgtgaatgcagagaactgtgactccagc
ctgaatcgaacctacgccatctcttcctcgctcatcagcttctacatccccgttgccatc
atgatcgtgacctacacgcgcatctaccgcatcgcccaggtgcagatccgcaggatttcc
tccctggagagggccgcagagcacgcgcagagctgccggagcagcgcagcctgcgcgccc
gacaccagcctgcgcgcttccatcaagaaggagaccaaggttctcaagaccctgtcggtg
atcatgggggtcttcgtgtgttgctggctgcccttcttcatccttaactgcatggtccct
ttctgcagtggacaccccgaaggccctccggccggcttcccctgcgtcagtgagaccacc
ttcgacgtcttcgtctggttcggctgggctaactcctcactcaaccccgtcatctatgcc
ttcaacgccgactttcagaaggtgtttgcccagctgctggggtgcagccacttctgctcc
cgcacgccggtggagacggtgaacatcagcaatgagctcatctcctacaaccaagacatc
gtcttccacaaggaaatcgcagctgcctacatccacatgatgcccaacgccgttaccccc
ggcaaccgggaggtggacaacgacgaggaggagggtcctttcgatcgcatgttccagatc
tatcagacgtccccagatggtgaccctgttgctgagtctgtctgggagctggactgcgag
ggggagatttctttagacaaaataacacctttcaccccgaatggattccattaa

KEGG   Homo sapiens (human): 2492Help
Entry
2492              CDS       T01001                                 

Gene name
FSHR, FSHR1, FSHRO, LGR1, ODG1
Definition
(RefSeq) follicle stimulating hormone receptor
  KO
K04247  follicle stimulating hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04913  Ovarian steroidogenesis
Disease
H00599  46,XX gonadal dysgenesis
H01039  Ovarian hyperstimulation syndrome
Drug target
Chorionic gonadotrophin: D06457
Corifollitropin alfa: D08895
Follitropin alfa: D04429
Follitropin beta: D04430
Follitropin delta: D06400
Human menopausal gonadotrophin (DG00472): D02692 D06459
Serum gonadotrophin: D05258
Urofollitropin: D06269
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2492 (FSHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2492 (FSHR)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    2492 (FSHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2492 (FSHR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Follicle stimulating hormone (FSH)
    2492 (FSHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 GnHR_trans LRR_8 LRR_5 LRRNT LRR_4 LRR_9
Motif
Other DBs
NCBI-GeneID: 2492
NCBI-ProteinID: NP_000136
OMIM: 136435
HGNC: 3969
Ensembl: ENSG00000170820
Vega: OTTHUMG00000129259
Pharos: P23945(Tclin)
UniProt: P23945 A0A1D5RMN4
LinkDB All DBs
Structure
PDB: 

Position
2p16.3
AA seq 695 aa AA seqDB search
MALLLVSLLAFLSLGSGCHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRV
IQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLP
NLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKN
GIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLEN
LKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQE
VDYMTQARGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDAFNPCEDIM
GYNILRVLIWFISILAITGNIIVLVILTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIAS
VDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLTAITLERWHTITHAMQLDCK
VQLRHAASVMVMGWIFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMSLLVLNVL
AFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMAMLIFTDFLCMAPISFFAISASLKVP
LITVSKAKILLVLFHPINSCANPFLYAIFTKNFRRDFFILLSKCGCYEMQAQIYRTETSS
TVHNTHPRNGHCSSAPRVTSGSTYILVPLSHLAQN
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctcctggtctctttgctggcattcctgagcttgggctcaggatgtcatcat
cggatctgtcactgctctaacagggtttttctctgccaagagagcaaggtgacagagatt
ccttctgacctcccgaggaatgccattgaactgaggtttgtcctcaccaagcttcgagtc
atccaaaaaggtgcattttcaggatttggggacctggagaaaatagagatctctcagaat
gatgtcttggaggtgatagaggcagatgtgttctccaaccttcccaaattacatgaaatt
agaattgaaaaggccaacaacctgctctacatcaaccctgaggccttccagaaccttccc
aaccttcaatatctgttaatatccaacacaggtattaagcaccttccagatgttcacaag
attcattctctccaaaaagttttacttgacattcaagataacataaacatccacacaatt
gaaagaaattctttcgtggggctgagctttgaaagtgtgattctatggctgaataagaat
gggattcaagaaatacacaactgtgcattcaatggaacccaactagatgagctgaatcta
agcgataataataatttagaagaattgcctaatgatgttttccacggagcctctggacca
gtcattctagatatttcaagaacaaggatccattccctgcctagctatggcttagaaaat
cttaagaagctgagggccaggtcgacttacaacttaaaaaagctgcctactctggaaaag
cttgtcgccctcatggaagccagcctcacctatcccagccattgctgtgcctttgcaaac
tggagacggcaaatctctgagcttcatccaatttgcaacaaatctattttaaggcaagaa
gttgattatatgactcaggctaggggtcagagatcctctctggcagaagacaatgagtcc
agctacagcagaggatttgacatgacgtacactgagtttgactatgacttatgcaatgaa
gtggttgacgtgacctgctcccctaagccagatgcattcaacccatgtgaagatatcatg
gggtacaacatcctcagagtcctgatatggtttatcagcatcctggccatcactgggaac
atcatagtgctagtgatcctaactaccagccaatataaactcacagtccccaggttcctt
atgtgcaacctggcctttgctgatctctgcattggaatctacctgctgctcattgcatca
gttgatatccataccaagagccaatatcacaactatgccattgactggcaaactggggca
ggctgtgatgctgctggctttttcactgtctttgccagtgagctgtcagtctacactctg
acagctatcaccttggaaagatggcataccatcacgcatgccatgcagctggactgcaag
gtgcagctccgccatgctgccagtgtcatggtgatgggctggatttttgcttttgcagct
gccctctttcccatctttggcatcagcagctacatgaaggtgagcatctgcctgcccatg
gatattgacagccctttgtcacagctgtatgtcatgtccctccttgtgctcaatgtcctg
gcctttgtggtcatctgtggctgctatatccacatctacctcacagtgcggaaccccaac
atcgtgtcctcctctagtgacaccaggatcgccaagcgcatggccatgctcatcttcact
gacttcctctgcatggcacccatttctttctttgccatttctgcctccctcaaggtgccc
ctcatcactgtgtccaaagcaaagattctgctggttctgtttcaccccatcaactcctgt
gccaaccccttcctctatgccatctttaccaaaaactttcgcagagatttcttcattctg
ctgagcaagtgtggctgctatgaaatgcaagcccaaatttataggacagaaacttcatcc
actgtccacaacacccatccaaggaatggccactgctcttcagctcccagagtcaccagt
ggttccacttacatacttgtccctctaagtcatttagcccaaaactaa

KEGG   Homo sapiens (human): 2696Help
Entry
2696              CDS       T01001                                 

Gene name
GIPR, PGQTL2
Definition
(RefSeq) gastric inhibitory polypeptide receptor
  KO
K04580  gastric inhibitory polypeptide receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Tirzepatide: D11360
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2696 (GIPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2696 (GIPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2696 (GIPR)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Gut peptide
   Gastric inhibitory peptide (GIP)
    2696 (GIPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 2696
NCBI-ProteinID: NP_000155
OMIM: 137241
HGNC: 4271
Ensembl: ENSG00000010310
Vega: OTTHUMG00000182129
Pharos: P48546(Tchem)
UniProt: P48546
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 466 aa AA seqDB search
MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLA
CNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCEN
PEKNEAFLDQRLILERLQVMYTVGYSLSLATLLLALLILSLFRRLHCTRNYIHINLFTSF
MLRAAAILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQYCVGANYTWLLVEGVY
LHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIR
TPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPV
TEEQARGALRFAKLGFEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQ
RQLPERAFRALPSGSGPGEVPTSRGLSSGTLPGPGNEASRELESYC
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactacctctccgatcctgcagctgctgctgcggctctcactgtgcgggctgctgctc
cagagggcggagacaggctctaaggggcagacggcgggggagctgtaccagcgctgggaa
cggtaccgcagggagtgccaggagaccttggcagccgcggaaccgccttcaggcctcgcc
tgtaacgggtccttcgatatgtacgtctgctgggactatgctgcacccaatgccactgcc
cgtgcgtcctgcccctggtacctgccctggcaccaccatgtggctgcaggtttcgtcctc
cgccagtgtggcagtgatggccaatggggactttggagagaccatacacaatgtgagaac
ccagagaagaatgaggcctttctggaccaaaggctcatcttggagcggttgcaggtcatg
tacactgtcggctactccctgtctctcgccacactgctgctagccctgctcatcttgagt
ttgttcaggcggctacattgcactagaaactatatccacatcaacctgttcacgtctttc
atgctgcgagctgcggccattctcagccgagaccgtctgctacctcgacctggcccctac
cttggggaccaggcccttgcgctgtggaaccaggccctcgctgcctgccgcacggcccag
atcgtgacccagtactgcgtgggtgccaactacacgtggctgctggtggagggcgtctac
ctgcacagtctcctggtgctcgtgggaggctccgaggagggccacttccgctactacctg
ctcctcggctggggggcccccgcgcttttcgtcattccctgggtgatcgtcaggtacctg
tacgagaacacgcagtgctgggagcgcaacgaagtcaaggccatttggtggattatacgg
acccccatcctcatgaccatcttgattaatttcctcatttttatccgcattcttggcatt
ctcctgtccaagctgaggacacggcaaatgcgctgccgggattaccggctgaggctggct
cgctccacgctgacgctggtgcccctgctgggtgtccacgaggtggtgtttgctcccgtg
acagaggaacaggcccggggcgccctgcgcttcgccaagctcggctttgagatcttcctc
agctccttccagggcttcctggtcagcgtcctctactgcttcatcaacaaggaggtgcag
tcggagatccgccgtggctggcaccactgccgcctgcgccgcagcctgggcgaggagcaa
cgccagctcccggagcgcgccttccgggccctgccctccggctccggcccgggcgaggtc
cccaccagccgcggcttgtcctcggggaccctcccagggcctgggaatgaggccagccgg
gagttggaaagttactgctag

KEGG   Homo sapiens (human): 2740Help
Entry
2740              CDS       T01001                                 

Gene name
GLP1R, GLP-1, GLP-1-R, GLP-1R
Definition
(RefSeq) glucagon like peptide 1 receptor
  KO
K04581  glucagon-like peptide 1 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04911  Insulin secretion
Drug target
Albiglutide: D08843
Avexitide: D11418
Avexitide acetate: D11419
Dulaglutide: D09889
Exenatide: D04121
Liraglutide: D06404
Lixisenatide: D09729
Pegapamodutide: D10970
Semaglutide: D10025
Taspoglutide: D09723
Tirzepatide: D11360
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2740 (GLP1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2740 (GLP1R)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    2740 (GLP1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2740 (GLP1R)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Pancreatic peptide
   Glucagon
    2740 (GLP1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 2740
NCBI-ProteinID: NP_002053
OMIM: 138032
HGNC: 4324
Ensembl: ENSG00000112164
Vega: OTTHUMG00000014638
Pharos: P43220(Tclin)
UniProt: P43220 A0A142FHB8
LinkDB All DBs
Structure
PDB: 

Position
6p21.2
AA seq 463 aa AA seqDB search
MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL
FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW
RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN
YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcccccggcccgctgcgccttgcgctgctgctgctcgggatggtgggcagg
gccggcccccgcccccagggtgccactgtgtccctctgggagacggtgcagaaatggcga
gaataccgacgccagtgccagcgctccctgactgaggatccacctcctgccacagacttg
ttctgcaaccggaccttcgatgaatacgcctgctggccagatggggagccaggctcgttc
gtgaatgtcagctgcccctggtacctgccctgggccagcagtgtgccgcagggccacgtg
taccggttctgcacagctgaaggcctctggctgcagaaggacaactccagcctgccctgg
agggacttgtcggagtgcgaggagtccaagcgaggggaaagaagctccccggaggagcag
ctcctgttcctctacatcatctacacggtgggctacgcactctccttctctgctctggtt
atcgcctctgcgatcctcctcggcttcagacacctgcactgcaccaggaactacatccac
ctgaacctgtttgcatccttcatcctgcgagcattgtccgtcttcatcaaggacgcagcc
ctgaagtggatgtatagcacagccgcccagcagcaccagtgggatgggctcctctcctac
caggactctctgagctgccgcctggtgtttctgctcatgcagtactgtgtggcggccaat
tactactggctcttggtggagggcgtgtacctgtacacactgctggccttctcggtctta
tctgagcaatggatcttcaggctctacgtgagcataggctggggtgttcccctgctgttt
gttgtcccctggggcattgtcaagtacctctatgaggacgagggctgctggaccaggaac
tccaacatgaactactggctcattatccggctgcccattctctttgccattggggtgaac
ttcctcatctttgttcgggtcatctgcatcgtggtatccaaactgaaggccaatctcatg
tgcaagacagacatcaaatgcagacttgccaagtccacgctgacactcatccccctgctg
gggactcatgaggtcatctttgcctttgtgatggacgagcacgcccgggggaccctgcgc
ttcatcaagctgtttacagagctctccttcacctccttccaggggctgatggtggccata
ttatactgctttgtcaacaatgaggtccagctggaatttcggaagagctgggagcgctgg
cggcttgagcacttgcacatccagagggacagcagcatgaagcccctcaagtgtcccacc
agcagcctgagcagtggagccacggcgggcagcagcatgtacacagccacttgccaggcc
tcctgcagctga

KEGG   Homo sapiens (human): 3360Help
Entry
3360              CDS       T01001                                 

Gene name
HTR4, 5-HT4, 5-HT4R
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Cinitapride (DG01520): D07700 D07701
Cisapride (DG00056): D00274 D02092
Fabesetron hydrochloride: D01838
Mosapride (DG01285): D01994 D08236
Naronapride (DG01335): D09933 D09934
Piboserod hydrochloride: D05471
Prucalopride (DG00080): D09205 D10152
Relenopride (DG02948): D11220 D11221
Renzapride: D06396
Sulamserod hydrochloride: D05941
Tegaserod (DG00081): D02730 D06056
Velusetrag (DG01336): D09693 D09694
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3360 (HTR4)
   04024 cAMP signaling pathway
    3360 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3360 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3360 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3360 (HTR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3360 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 3360
NCBI-ProteinID: NP_000861
OMIM: 602164
HGNC: 5299
Ensembl: ENSG00000164270
Vega: OTTHUMG00000129931
Pharos: Q13639(Tclin)
UniProt: Q13639 A0A2D3FAF9
LinkDB All DBs
Position
5q32
AA seq 388 aa AA seqDB search
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttgatgctaatgtgagttctgaggagggtttcgggtcagtggagaaggtg
gtgctgctcacgtttctctcgacggttatcctgatggccatcttggggaacctgctggtg
atggtggctgtgtgctgggacaggcagctcaggaaaataaaaacaaattatttcattgta
tctcttgcttttgcggatctgctggtttcggtgctggtgatgccctttggtgccattgag
ctggttcaagacatctggatttatggggaggtgttttgtcttgttcggacatctctggac
gtcctgctcacaacggcatcgatttttcacctgtgctgcatttctctggataggtattac
gccatctgctgccagcctttggtctataggaacaagatgacccctctgcgcatcgcatta
atgctgggaggctgctgggtcatccccacgtttatttcttttctccctataatgcaaggc
tggaataacattggcataattgatttgatagaaaagaggaagttcaaccagaactctaac
tctacgtactgtgtcttcatggtcaacaagccctacgccatcacctgctctgtggtggcc
ttctacatcccatttctcctcatggtgctggcctattaccgcatctatgtcacagctaag
gagcatgcccatcagatccagatgttacaacgggcaggagcctcctccgagagcaggcct
cagtcggcagaccagcatagcactcatcgcatgaggacagagaccaaagcagccaagacc
ctgtgcatcatcatgggttgcttctgcctctgctgggcaccattctttgtcaccaatatt
gtggatcctttcatagactacactgtccctgggcaggtgtggactgctttcctctggctc
ggctatatcaattccgggttgaacccttttctctacgccttcttgaataagtcttttaga
cgtgccttcctcatcatcctctgctgtgatgatgagcgctaccgaagaccttccattctg
ggccagactgtcccttgttcaaccacaaccattaatggatccacacatgtactaagggat
gcagtggagtgtggtggccagtgggagagtcagtgtcacccgccagcaacttctcctttg
gtggctgctcagcccagtgacacttag

KEGG   Homo sapiens (human): 3362Help
Entry
3362              CDS       T01001                                 

Gene name
HTR6, 5-HT6, 5-HT6R
Definition
(RefSeq) 5-hydroxytryptamine receptor 6
  KO
K04162  5-hydroxytryptamine receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Asenapine: D02995
Cerlapirdine (DG01337): D10099 D10100
Idalopirdine (DG01878): D10710 D10747
Olanzapine (DG00898): D00454 D06623
Tiospirone hydrochloride: D02688
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3362 (HTR6)
   04024 cAMP signaling pathway
    3362 (HTR6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3362 (HTR6)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3362 (HTR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3362 (HTR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3362 (HTR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx DUF1385
Motif
Other DBs
NCBI-GeneID: 3362
NCBI-ProteinID: NP_000862
OMIM: 601109
HGNC: 5301
Ensembl: ENSG00000158748
Vega: OTTHUMG00000002713
Pharos: P50406(Tchem)
UniProt: P50406
LinkDB All DBs
Position
1p36.13
AA seq 440 aa AA seqDB search
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtcccagagccgggcccaaccgccaatagcaccccggcctggggggcagggccgccg
tcggccccggggggcagcggctgggtggcggccgcgctgtgcgtggtcatcgcgctgacg
gcggcggccaactcgctgctgatcgcgctcatctgcactcagcccgcgctgcgcaacacg
tccaacttcttcctggtgtcgctcttcacgtctgacctgatggtggggctggtggtgatg
ccgccggccatgctgaacgcgctgtacgggcgctgggtgctggcgcgcggcctctgcctg
ctctggaccgccttcgacgtgatgtgctgcagcgcctccatcctcaacctctgcctcatc
agcctggaccgctacctgctcatcctctcgccgctgcgctacaagctgcgcatgacgccc
ctgcgtgccctggccctagtcctgggcgcctggagcctcgccgctctcgcctccttcctg
cccctgctgctgggctggcacgagctgggccacgcacggccacccgtccctggccagtgc
cgcctgctggccagcctgccttttgtccttgtggcgtcgggcctcaccttcttcctgccc
tcgggtgccatatgcttcacctactgcaggatcctgctagctgcccgcaagcaggccgtg
caggtggcctccctcaccaccggcatggccagtcaggcctcggagacgctgcaggtgccc
aggaccccacgcccaggggtggagtctgctgacagcaggcgtctagccacgaagcacagc
aggaaggccctgaaggccagcctgacgctgggcatcctgctgggcatgttctttgtgacc
tggttgcccttctttgtggccaacatagtccaggccgtgtgcgactgcatctccccaggc
ctcttcgatgtcctcacatggctgggttactgtaacagcaccatgaaccccatcatctac
ccactcttcatgcgggacttcaagcgggcgctgggcaggttcctgccatgtccacgctgt
ccccgggagcgccaggccagcctggcctcgccatcactgcgcacctctcacagcggcccc
cggcccggccttagcctacagcaggtgctgccgctgcccctgccgccggactcagattcg
gactcagacgcaggctcaggcggctcctcgggcctgcggctcacggcccagctgctgctt
cctggcgaggccacccaggaccccccgctgcccaccagggccgctgccgccgtcaatttc
ttcaacatcgaccccgcggagcccgagctgcggccgcatccacttggcatccccacgaac
tga

KEGG   Homo sapiens (human): 4158Help
Entry
4158              CDS       T01001                                 

Gene name
MC2R, ACTHR
Definition
(RefSeq) melanocortin 2 receptor
  KO
K04200  melanocortin 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00299  Mutation-inactivated MC2R to ACTH-cortisol signaling pathway
N00300  Mutation-inactivated MRAP to ACTH-cortisol signaling pathway
Disease
H00033  Adrenal carcinoma
H00256  Familial glucocorticoid deficiency
H01431  Cushing syndrome
H02049  Bilateral macronodular adrenal hyperplasia
Drug target
Alsactide: D07417
Corticotropin (DG00492): D00146 D03593 D06544
Giractide (DG01344): D09801 D09937
Seractide acetate: D05827
Tetracosactide (DG00493): D00284 D02105
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    4158 (MC2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4158 (MC2R)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    4158 (MC2R)
   04927 Cortisol synthesis and secretion
    4158 (MC2R)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    4158 (MC2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4158 (MC2R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Melanocortin
    4158 (MC2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 4158
NCBI-ProteinID: NP_000520
OMIM: 607397
HGNC: 6930
Ensembl: ENSG00000185231
Vega: OTTHUMG00000131721
Pharos: Q01718(Tclin)
UniProt: Q01718
LinkDB All DBs
Position
18p11.21
AA seq 297 aa AA seqDB search
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMY
FFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFS
LSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTS
LFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVL
LMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacattatcaactcgtatgaaaacatcaacaacacagcaagaaataattccgac
tgtcctcgtgtggttttgccggaggagatatttttcacaatttccattgttggagttttg
gagaatctgatcgtcctgctggctgtgttcaagaataagaatctccaggcacccatgtac
tttttcatctgtagcttggccatatctgatatgctgggcagcctatataagatcttggaa
aatatcctgatcatattgagaaacatgggctatctcaagccacgtggcagttttgaaacc
acagccgatgacatcatcgactccctgtttgtcctctccctgcttggctccatcttcagc
ctgtctgtgattgctgcggaccgctacatcaccatcttccacgcactgcggtaccacagc
atcgtgaccatgcgccgcactgtggtggtgcttacggtcatctggacgttctgcacgggg
actggcatcaccatggtgatcttctcccatcatgtgcccacagtgatcaccttcacgtcg
ctgttcccgctgatgctggtcttcatcctgtgcctctatgtgcacatgttcctgctggct
cgatcccacaccaggaagatctccaccctccccagagccaacatgaaaggggccatcaca
ctgaccatcctgctcggggtcttcatcttctgctgggccccctttgtgcttcatgtcctc
ttgatgacattctgcccaagtaacccctactgcgcctgctacatgtctctcttccaggtg
aacggcatgttgatcatgtgcaatgccgtcattgaccccttcatatatgccttccggagc
ccagagctcagggacgcattcaaaaagatgatcttctgcagcaggtactggtag

KEGG   Homo sapiens (human): 4881Help
Entry
4881              CDS       T01001                                 

Gene name
NPR1, ANPRA, ANPa, GUC2A, GUCY2A, NPRA
Definition
(RefSeq) natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04714  Thermogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
Drug target
Anaritide acetate: D02935
Carperitide: D03328
Cenderitide: D10063
Eritrityl tetranitrate: D04051
Nesiritide (DG00238): D05147 D05148
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4881 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    4881 (NPR1)
   04022 cGMP-PKG signaling pathway
    4881 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    4881 (NPR1)
   04921 Oxytocin signaling pathway
    4881 (NPR1)
   04924 Renin secretion
    4881 (NPR1)
   04925 Aldosterone synthesis and secretion
    4881 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    4881 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4881 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4881 (NPR1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     4881 (NPR1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   4881 (NPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA
Motif
Other DBs
NCBI-GeneID: 4881
NCBI-ProteinID: NP_000897
OMIM: 108960
HGNC: 7943
Ensembl: ENSG00000169418
Vega: OTTHUMG00000037085
Pharos: P16066(Tclin)
UniProt: P16066 A0A140VJE6
LinkDB All DBs
Position
1q21.3
AA seq 1061 aa AA seqDB search
MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgccggggccccggcgccccgctggctcccgcctgcgcctgctcctgctcctgctgctg
ccgccgctgctgctgctgctccggggcagccacgcgggcaacctgacggtagccgtggta
ctgccgctggccaatacctcgtacccctggtcgtgggcgcgcgtgggacccgccgtggag
ctggccctggcccaggtgaaggcgcgccccgacttgctgccgggctggacggtccgcacg
gtgctgggcagcagcgaaaacgcgctgggcgtctgctccgacaccgcagcgcccctggcc
gcggtggacctcaagtgggagcacaaccccgctgtgttcctgggccccggctgcgtgtac
gccgccgccccagtggggcgcttcaccgcgcactggcgggtcccgctgctgaccgccggc
gccccggcgctgggcttcggtgtcaaggacgagtatgcgctgaccacccgcgcggggccc
agctacgccaagctgggggacttcgtggcggcgctgcaccgacggctgggctgggagcgc
caagcgctcatgctctacgcctaccggccgggtgacgaagagcactgcttcttcctcgtg
gaggggctgttcatgcgggtccgcgaccgcctcaatattacggtggaccacctggagttc
gccgaggacgacctcagccactacaccaggctgctgcggaccatgccgcgcaaaggccga
gttatctacatctgcagctcccctgatgccttcagaaccctcatgctcctggccctggaa
gctggcttgtgtggggaggactacgttttcttccacctggatatctttgggcaaagcctg
caaggtggacagggccctgctccccgcaggccctgggagagaggggatgggcaggatgtc
agtgcccgccaggcctttcaggctgccaaaatcattacatataaagacccagataatccc
gagtacttggaattcctgaagcagttaaaacacctggcctatgagcagttcaacttcacc
atggaggatggcctggtgaacaccatcccagcatccttccacgacgggctcctgctctat
atccaggcagtgacggagactctggcacatgggggaactgttactgatggggagaacatc
actcagcggatgtggaaccgaagctttcaaggtgtgacaggatacctgaaaattgatagc
agtggcgatcgggaaacagacttctccctctgggatatggatcccgagaatggtgccttc
agggttgtactgaactacaatgggacttcccaagagctggtggctgtgtcggggcgcaaa
ctgaactggcccctggggtaccctcctcctgacatccccaaatgtggctttgacaacgaa
gacccagcatgcaaccaagatcacctttccaccctggaggtgctggctttggtgggcagc
ctctccttgctcggcattctgattgtctccttcttcatatacaggaagatgcagctggag
aaggaactggcctcggagctgtggcgggtgcgctgggaggacgttgagcccagtagcctt
gagaggcacctgcggagtgcaggcagccggctgaccctgagcgggagaggctccaattac
ggctccctgctaaccacagagggccagttccaagtctttgccaagacagcatattataag
ggcaacctcgtggctgtgaaacgtgtgaaccgtaaacgcattgagctgacacgaaaagtc
ctgtttgaactgaagcatatgcgggatgtgcagaatgaacacctgaccaggtttgtggga
gcctgcaccgacccccccaatatctgcatcctcacagagtactgtccccgtgggagcctg
caggacattctggagaatgagagcatcaccctggactggatgttccggtactcactcacc
aatgacatcgtcaagggcatgctgtttctacacaatggggctatctgttcccatgggaac
ctcaagtcatccaactgcgtggtagatgggcgctttgtgctcaagatcaccgactatggg
ctggagagcttcagggacctggacccagagcaaggacacaccgtttatgccaaaaagctg
tggacggcccctgagctcctgcgaatggcttcaccccctgtgcggggctcccaggctggt
gacgtatacagctttgggatcatccttcaggagattgccctgaggagtggggtcttccac
gtggaaggtttggacctgagccccaaagagatcatcgagcgggtgactcggggtgagcag
ccccccttccggccctccctggccctgcagagtcacctggaggagttggggctgctcatg
cagcggtgctgggctgaggacccacaggagaggccaccattccagcagatccgcctgacg
ttgcgcaaatttaacagggagaacagcagcaacatcctggacaacctgctgtcccgcatg
gagcagtacgcgaacaatctggaggaactggtggaggagcggacccaggcatacctggag
gagaagcgcaaggctgaggccctgctctaccagatcctgcctcactcagtggctgagcag
ctgaagcgtggggagacggtgcaggccgaagcctttgacagtgttaccatctacttcagt
gacattgtgggtttcacagcgctgtcggcggagagcacacccatgcaggtggtgaccctg
ctcaatgacctgtacacttgctttgatgctgtcatagacaactttgatgtgtacaaggtg
gagacaattggcgatgcctacatggtggtgtcagggctccctgtgcggaacgggcggcta
cacgcctgcgaggtagcccgcatggccctggcactgctggatgctgtgcgctccttccga
atccgccaccggccccaggagcagctgcgcttgcgcattggcatccacacaggacctgtg
tgtgctggagtggtgggactgaagatgccccgttactgtctctttggggatacagtcaac
acagcctcaagaatggagtctaatggggaagccctgaagatccacttgtcttctgagacc
aaggctgtcctggaggagtttggtggtttcgagctggagcttcgaggggatgtagaaatg
aagggcaaaggcaaggttcggacctactggctccttggggagagggggagtagcacccga
ggctga

KEGG   Homo sapiens (human): 5732Help
Entry
5732              CDS       T01001                                 

Gene name
PTGER2, EP2
Definition
(RefSeq) prostaglandin E receptor 2
  KO
K04259  prostaglandin E receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04924  Renin secretion
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Disease
H01191  Asthma with nasal polyps and aspirin intolerance
Drug target
Arbaprostil: D02975
Butaprost: D03187
Dinoprostone (DG00448): D00079 D03269
Enprostil: D01891
Evatanepag (DG01894): D09613 D09614
Meteneprost: D02726
Misoprostol: D00419
Omidenepag (DG02831): D10965 D10966
Rioprostil: D05732
Sulprostone: D02725
Taprenepag (DG01895): D09968 D09969
Trimoprostil: D06240
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5732 (PTGER2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5732 (PTGER2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    5732 (PTGER2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    5732 (PTGER2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5732 (PTGER2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    5732 (PTGER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    5732 (PTGER2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    5732 (PTGER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Srg DUF412
Motif
Other DBs
NCBI-GeneID: 5732
NCBI-ProteinID: NP_000947
OMIM: 176804
HGNC: 9594
Ensembl: ENSG00000125384
Vega: OTTHUMG00000140300
Pharos: P43116(Tclin)
UniProt: P43116
LinkDB All DBs
Position
14q22.1
AA seq 358 aa AA seqDB search
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgggcaatgcctccaatgactcccagtctgaggactgcgagacgcgacagtggcttccc
ccaggcgaaagcccagccatcagctccgtcatgttctcggccggggtgctggggaacctc
atagcactggcgctgctggcgcgccgctggcggggggacgtggggtgcagcgccggccgc
aggagctccctctccttgttccacgtgctggtgaccgagctggtgttcaccgacctgctc
gggacctgcctcatcagcccagtggtactggcttcgtacgcgcggaaccagaccctggtg
gcactggcgcccgagagccgcgcgtgcacctacttcgctttcgccatgaccttcttcagc
ctggccacgatgctcatgctcttcgccatggccctggagcgctacctctcgatcgggcac
ccctacttctaccagcgccgcgtctcgcgctccgggggcctggccgtgctgcctgtcatc
tatgcagtctccctgctcttctgctcgctgccgctgctggactatgggcagtacgtccag
tactgccccgggacctggtgcttcatccggcacgggcggaccgcttacctgcagctgtac
gccaccctgctgctgcttctcattgtctcggtgctcgcctgcaacttcagtgtcattctc
aacctcatccgcatgcaccgccgaagccggagaagccgctgcggaccttccctgggcagt
ggccggggcggccccggggcccgcaggagaggggaaagggtgtccatggcggaggagacg
gaccacctcattctcctggctatcatgaccatcaccttcgccgtctgctccttgcctttc
acgatttttgcatatatgaatgaaacctcttcccgaaaggaaaaatgggacctccaagct
cttaggtttttatcaattaattcaataattgacccttgggtctttgccatccttaggcct
cctgttctgagactaatgcgttcagtcctctgttgtcggatttcattaagaacacaagat
gcaacacaaacttcctgttctacacagtcagatgccagtaaacaggctgacctttga

KEGG   Homo sapiens (human): 7253Help
Entry
7253              CDS       T01001                                 

Gene name
TSHR, CHNG1, LGR3, hTSHR-I
Definition
(RefSeq) thyroid stimulating hormone receptor
  KO
K04249  thyrotropin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04918  Thyroid hormone synthesis
hsa04923  Regulation of lipolysis in adipocytes
hsa05320  Autoimmune thyroid disease
Network
nt06322  TSH-TG/TH-THR signaling
  Element
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00793  TSH-DUOX2-TG signaling pathway
N00794  Mutation-inactivated DUOX2 to TSH-DUOX2-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
Disease
H00250  Congenital nongoitrous hypothyroidism (CHNG)
H01269  Congenital hyperthyroidism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    7253 (TSHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7253 (TSHR)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    7253 (TSHR)
   04918 Thyroid hormone synthesis
    7253 (TSHR)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    7253 (TSHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7253 (TSHR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thyrotropin
    7253 (TSHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 LRR_8 LRR_5 SSFA2_C
Motif
Other DBs
NCBI-GeneID: 7253
NCBI-ProteinID: NP_000360
OMIM: 603372
HGNC: 12373
Ensembl: ENSG00000165409
Vega: OTTHUMG00000171429
Pharos: P16473(Tclin)
UniProt: P16473 A0A0A0MTJ0
LinkDB All DBs
Structure
PDB: 

Position
14q31.1
AA seq 764 aa AA seqDB search
MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLI
ETHLRTIPSHAFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPD
ALKELPLLKFLGIFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETL
TLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTA
LPSKGLEHLKELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM
CNESSMQSLRQRKSVNALNSPLHQEYEENLGDSIVGYKEKSKFQDTHNNAHYYVFFEEQE
DEIIGFGQELKNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIV
VWFVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSE
YYNHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACA
IMVGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCC
YVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFICMAPISFYALSAILNKPLITVSNSK
ILLVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRGQRVPPKNSTDIQ
VQKVTHEMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaggccggcggacttgctgcagctggtgctgctgctcgacctgcccagggacctgggc
ggaatggggtgttcgtctccaccctgcgagtgccatcaggaggaggacttcagagtcacc
tgcaaggatattcaacgcatccccagcttaccgcccagtacgcagactctgaagcttatt
gagactcacctgagaactattccaagtcatgcattttctaatctgcccaatatttccaga
atctacgtatctatagatgtgactctgcagcagctggaatcacactccttctacaatttg
agtaaagtgactcacatagaaattcggaataccaggaacttaacttacatagaccctgat
gccctcaaagagctccccctcctaaagttccttggcattttcaacactggacttaaaatg
ttccctgacctgaccaaagtttattccactgatatattctttatacttgaaattacagac
aacccttacatgacgtcaatccctgtgaatgcttttcagggactatgcaatgaaaccttg
acactgaagctgtacaacaatggctttacttcagtccaaggatatgctttcaatgggaca
aagctggatgctgtttacctaaacaagaataaatacctgacagttattgacaaagatgca
tttggaggagtatacagtggaccaagcttgctggacgtgtctcaaaccagtgtcactgcc
cttccatccaaaggcctggagcacctgaaggaactgatagcaagaaacacctggactctt
aagaaacttccactttccttgagtttccttcacctcacacgggctgacctttcttaccca
agccactgctgtgcttttaagaatcagaagaaaatcagaggaatccttgagtccttgatg
tgtaatgagagcagtatgcagagcttgcgccagagaaaatctgtgaatgccttgaatagc
cccctccaccaggaatatgaagagaatctgggtgacagcattgttgggtacaaggaaaag
tccaagttccaggatactcataacaacgctcattattacgtcttctttgaagaacaagag
gatgagatcattggttttggccaggagctcaaaaacccccaggaagagactctacaagct
tttgacagccattatgactacaccatatgtggggacagtgaagacatggtgtgtaccccc
aagtccgatgagttcaacccgtgtgaagacataatgggctacaagttcctgagaattgtg
gtgtggttcgttagtctgctggctctcctgggcaatgtctttgtcctgcttattctcctc
accagccactacaaactgaacgtcccccgctttctcatgtgcaacctggcctttgcggat
ttctgcatggggatgtacctgctcctcatcgcctctgtagacctctacactcactctgag
tactacaaccatgccatcgactggcagacaggccctgggtgcaacacggctggtttcttc
actgtctttgcaagcgagttatcggtgtatacgctgacggtcatcaccctggagcgctgg
tatgccatcaccttcgccatgcgcctggaccggaagatccgcctcaggcacgcatgtgcc
atcatggttgggggctgggtttgctgcttccttctcgccctgcttcctttggtgggaata
agtagctatgccaaagtcagtatctgcctgcccatggacaccgagacccctcttgctctg
gcatatattgtttttgttctgacgctcaacatagttgccttcgtcatcgtctgctgctgt
tatgtgaagatctacatcacagtccgaaatccgcagtacaacccaggggacaaagatacc
aaaattgccaagaggatggctgtgttgatcttcaccgacttcatatgcatggccccaatc
tcattctatgctctgtcagcaattctgaacaagcctctcatcactgttagcaactccaaa
atcttgctggtactcttctatccacttaactcctgtgccaatccattcctctatgctatt
ttcaccaaggccttccagagggatgtgttcatcctactcagcaagtttggcatctgtaaa
cgccaggctcaggcataccgggggcagagggttcctccaaagaacagcactgatattcag
gttcaaaaggttacccacgagatgaggcagggtctccacaacatggaagatgtctatgaa
ctgattgaaaactcccatctaaccccaaagaagcaaggccaaatctcagaagagtatatg
caaacggttttgtaa

KEGG   Homo sapiens (human): 7434Help
Entry
7434              CDS       T01001                                 

Gene name
VIPR2, C16DUPq36.3, DUP7q36.3, PACAP-R-3, PACAP-R3, VIP-R-2, VPAC2, VPAC2R, VPCAP2R
Definition
(RefSeq) vasoactive intestinal peptide receptor 2
  KO
K04590  vasoactive intestinal peptide receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    7434 (VIPR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7434 (VIPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7434 (VIPR2)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    7434 (VIPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 7434
NCBI-ProteinID: NP_003373
OMIM: 601970
HGNC: 12695
Ensembl: ENSG00000106018
Vega: OTTHUMG00000151446
Pharos: P41587(Tchem)
UniProt: P41587 X5D7Q6
LinkDB All DBs
Structure
PDB: 

Position
7q36.3
AA seq 438 aa AA seqDB search
MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNIT
CWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKI
TFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKD
DVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRC
FLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFI
SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFE
LCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ
FHRGSRAQSFLQTETSVI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgctgctgcctcccgcgctgctgacctgctggctgctcgcccccgtgaacagc
attcacccagaatgccgatttcatctggaaatacaggaggaagaaacaaaatgtgcagag
cttctgaggtctcaaacagaaaaacacaaagcctgcagtggcgtctgggacaacatcacg
tgctggcggcctgccaatgtgggagagaccgtcacggtgccctgcccaaaagtcttcagc
aatttttacagcaaagcaggaaacataagcaaaaactgtacgagtgacggatggtcagag
acgttcccagatttcgtcgatgcctgtggctacagcgacccggaggatgagagcaagatc
acgttttatattctggtgaaggccatttatacactgggctacagtgtctctctgatgtct
cttgcaacaggaagcataattctgtgcctcttcaggaagctgcactgcaccaggaattac
atccacctgaacctgttcctgtccttcatcctgagagccatctcagtgctggtcaaggac
gacgttctctactccagctctggcacgttgcactgccctgaccagccatcctcctgggtg
ggctgcaagctgagcctggtcttcctgcagtactgcatcatggccaacttcttctggctg
ctggtggaggggctctacctccacaccctcctggtggccatgctcccccctagaaggtgc
ttcctggcctacctcctgatcggatggggcctccccaccgtctgcatcggtgcatggact
gcggccaggctctacttagaagacaccggttgctgggatacaaacgaccacagtgtgccc
tggtgggtcatacgaataccgattttaatttccatcatcgtcaattttgtccttttcatt
agtattatacgaattttgctgcagaagttaacatccccagatgtcggcggcaacgaccag
tctcagtacaagaggctggccaagtccacgctcctgcttatcccgctgttcggcgtccac
tacatggtgtttgccgtgtttcccatcagcatctcctccaaataccagatactgtttgag
ctgtgcctcgggtcgttccagggcctggtggtggccgtcctctactgtttcctgaacagt
gaggtgcagtgcgagctgaagcgaaaatggcgaagccggtgcccgaccccgtccgcgagc
cgggattacagggtctgcggttcctccttctcccgcaacggctcggagggcgccctgcag
ttccaccgcggctcccgcgcccagtccttcctgcaaacggagacctcggtcatctag

DBGET integrated database retrieval system