KEGG   Homo sapiens (human): 117145Help
Entry
117145            CDS       T01001                                 

Gene name
THEM4, CTMP
Definition
(RefSeq) thioesterase superfamily member 4
  KO
K16339  acyl-coenzyme A thioesterase THEM4 [EC:3.1.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    117145 (THEM4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    117145 (THEM4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     117145 (THEM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 4HBT DUF2574
Motif
Other DBs
NCBI-GeneID: 117145
NCBI-ProteinID: NP_444283
OMIM: 606388
HGNC: 17947
Ensembl: ENSG00000159445
Vega: OTTHUMG00000013049
Pharos: Q5T1C6(Tbio)
UniProt: Q5T1C6 A8K0C9
LinkDB All DBs
Structure
PDB: 

Position
1q21.3
AA seq 240 aa AA seqDB search
MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLL
FDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLG
FEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANL
NINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggagctgcgccgcgcgcctccgcacgctgggggctctgtgcctgccgccagta
ggccggcgcctgccgggaagcgagccgcgacccgagctgaggtcattttcttctgaggaa
gtcattcttaaggactgttctgtccccaaccccagctggaacaaggacctaagactgctc
tttgaccagtttatgaagaaatgtgaagacggctcctggaaacgtttgccttcatataaa
cgtacacctactgaatggattcaagacttcaaaacccattttcttgacccaaagcttatg
aaagaagaacaaatgtcacaggcccagctcttcaccagaagctttgatgatggcctgggc
tttgaatacgtgatgttctacaatgacattgagaaaaggatggtttgcttatttcaagga
ggcccttacctggaaggaccacctggattcattcatggaggtgccattgcaaccatgatt
gatgctactgttggtatgtgtgcaatgatggctgggggaatcgtcatgactgccaatctc
aacatcaattataaaagacctatccctctttgttctgttgttatgataaatagccaactt
gataaagttgaaggaaggaaattttttgtttcctgtaatgttcagagtgttgatgagaag
accctatactcagaggcgacaagcttatttataaagctgaatcctgctaaaagtctgaca
taa

DBGET integrated database retrieval system