KEGG   Homo sapiens (human): 117157Help
Entry
117157            CDS       T01001                                 

Gene name
SH2D1B, EAT2
Definition
(RefSeq) SH2 domain containing 1B
  KO
K07989  EWS/FLI1 activated transcript 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    117157 (SH2D1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 AA_permease_N
Motif
Other DBs
NCBI-GeneID: 117157
NCBI-ProteinID: NP_444512
OMIM: 608510
HGNC: 30416
Ensembl: ENSG00000198574
Vega: OTTHUMG00000031377
Pharos: O14796(Tbio)
UniProt: O14796
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 132 aa AA seqDB search
MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKH
GYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETF
VNSNSDYVDVLP
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccttactaccatggacgtctgaccaagcaagactgtgagaccttgctgctc
aaggaaggggtggatggcaactttcttttaagagacagcgagtcgataccaggagtcctg
tgcctctgtgtctcgtttaaaaatattgtctacacataccgaatcttcagagagaaacac
gggtattacaggatacagactgcagaaggttctccaaaacaggtctttccaagcctaaag
gaactgatctccaaatttgaaaaaccaaatcaggggatggtggttcaccttttaaagcca
ataaagagaaccagccccagcttgagatggagaggattgaaattagagttggaaacattt
gtgaacagtaacagcgattatgtggatgtcttgccttga

DBGET integrated database retrieval system