KEGG   Homo sapiens (human): 117247Help
Entry
117247            CDS       T01001                                 

Gene name
SLC16A10, MCT10, PRO0813, TAT1
Definition
(RefSeq) solute carrier family 16 member 10
  KO
K08187  MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
hsa04974  Protein digestion and absorption ELEMENT   N00798  Thyroid hormone signaling pathway
N00799  Mutation-inactivated THRA to thyroid hormone signaling pathway
N00800  Mutation-inactivated THRB to thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    117247 (SLC16A10)
  09154 Digestive system
   04974 Protein digestion and absorption
    117247 (SLC16A10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    117247 (SLC16A10)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC16: Monocarboxylate transporter
   117247 (SLC16A10)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Monocarboxylate porter (MCP) family [TC:2.A.1.13]
    117247 (SLC16A10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 117247
NCBI-ProteinID: NP_061063
OMIM: 607550
HGNC: 17027
Ensembl: ENSG00000112394
Vega: OTTHUMG00000015371
Pharos: Q8TF71(Tbio)
UniProt: Q8TF71
LinkDB All DBs
Position
6q21
AA seq 515 aa AA seqDB search
MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHE
PPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSL
SMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGC
SFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIF
MFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGI
PLALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVY
LQVLSFFFIGLMSMMIPLCSIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI
GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREI
SKTTGKEKMEKMLENQNSLLSSSSGMFKKESDSII
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcccaggaggagccggactccgcgcggggcacgagcgaggcgcagccgctc
ggccccgcgcccacgggggccgctccgccgcccggcccgggaccctcggacagccccgag
gcggctgtcgagaaggtggaggtggagctggcggggccggcgaccgcggagccccatgag
ccccccgaaccccccgagggcggctggggctggctggtgatgctggcggccatgtggtgc
aacgggtcggtgttcggcatccagaacgcttgcggggtgctcttcgtgtccatgctggaa
accttcggctccaaagacgatgacaagatggtctttaagacagcatgggtaggttctctc
tccatggggatgattttcttttgctgcccaatagtcagcgtcttcacagacctatttggt
tgtcggaaaacagctgtcgtgggtgctgctgttggatttgttgggctcatgtccagttct
tttgtaagttccatcgagcctctgtaccttacctatggaatcatatttgcctgcggctgc
tcctttgcataccagccttcattggtcattttgggacactatttcaagaagcgccttgga
ctggtgaatggcattgtcactgctggcagcagtgtcttcacaatcctgctgcctttgctc
ttaagggttctgattgacagcgtgggcctcttttacacattgagggtgctctgcatcttc
atgtttgttctctttctggctggctttacttaccgacctcttgctaccagtaccaaagat
aaagagagtggaggtagcggatcctccctcttttccaggaaaaagttcagtcctccaaaa
aaaattttcaattttgccatcttcaaggtgacagcttatgcagtgtgggcagttggaata
ccacttgcactttttggatactttgtgccttatgttcacttgatgaaacatgtaaatgaa
agatttcaagatgaaaaaaataaagaggttgttctcatgtgcattggcgtcacttcagga
gttggacgactgctctttggccggattgcagattatgtgcctggtgtgaagaaggtttat
ctacaggtactctcctttttcttcattggtctgatgtccatgatgattcctctgtgtagc
atctttggggccctcattgctgtgtgcctcatcatgggtctcttcgatggatgcttcatt
tccattatggctcccatagcctttgagttagttggtgcccaggatgtctcccaagcaatt
ggatttctgctcggattcatgtctatacccatgactgttggcccacccattgcagggtta
cttcgtgacaaactgggctcctatgatgtggcattctacctcgctggagtccctcccctt
attggaggtgctgtgctttgttttatcccgtggatccatagtaagaagcaaagagagatc
agtaaaaccactggaaaagaaaagatggagaaaatgttggaaaaccagaactctctgctg
tcaagttcatctggaatgttcaagaaagaatctgactctattatttaa

KEGG   Homo sapiens (human): 6567Help
Entry
6567              CDS       T01001                                 

Gene name
SLC16A2, AHDS, DXS128, DXS128E, MCT_7, MCT_8, MCT7, MCT8, MRX22, XPCT
Definition
(RefSeq) solute carrier family 16 member 2
  KO
K08231  MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway ELEMENT   N00798  Thyroid hormone signaling pathway
N00799  Mutation-inactivated THRA to thyroid hormone signaling pathway
N00800  Mutation-inactivated THRB to thyroid hormone signaling pathway
Disease
H00650  Allan-Herndon-Dudley syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    6567 (SLC16A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6567 (SLC16A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC16: Monocarboxylate transporter
   6567 (SLC16A2)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Monocarboxylate porter (MCP) family [TC:2.A.1.13]
    6567 (SLC16A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Trypan_PARP TonB_N
Motif
Other DBs
NCBI-GeneID: 6567
NCBI-ProteinID: NP_006508
OMIM: 300095
HGNC: 10923
Ensembl: ENSG00000147100
Vega: OTTHUMG00000021857
Pharos: P36021(Tbio)
UniProt: P36021
LinkDB All DBs
Position
Xq13.2
AA seq 539 aa AA seqDB search
MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPD
PAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNS
VGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAV
AFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSS
IFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLH
QRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLL
VCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFL
GLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAF
YFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcaaagccaggcgagcgaggaagcaaaggggccctggcaggaggcagaccag
gaacagcaggagccggtgggtagcccagagccggagtctgagccggagcctgagcccgag
cccgagcccgtgccagtgcccccgcccgagccccagccggagccccagcccctaccggac
cccgcacccctgccggagctggagttcgagtccgagcgggtgcacgaacccgagcccacg
cctacggtagagacccgcggcaccgcgcgcggcttccagcctcccgaaggtggcttcggc
tgggtggtggtgttcgctgccacctggtgcaacggctccatcttcggcatccataactct
gtcgggatcctctactccatgctgctagaggaggaaaaggaaaaaaatcgccaagtggag
ttccaagcagcatgggtcggagccctcgcgatgggtatgatcttcttctgttctcccatt
gtgagtatattcactgaccgtttgggctgccgaatcacagcaaccgcgggggctgccgtt
gctttcattggcctccataccagctccttcaccagctccctaagcctgcgctacttcacc
tacgggattctctttggttgtggctgttccttcgcctttcagccatccctcgtcatcctg
ggccactactttcaacgccgcctgggtctggccaatggtgtggtgtctgctgggagtagc
attttctccatgtccttccccttcctcatcagaatgctgggggataagatcaagctggcc
caaaccttccaggtgctgagtaccttcatgtttgttcttatgctgctttcactcacctac
cggcccctcctgcccagctcccaggacaccccaagcaagagaggtgtccgcaccctgcac
cagcgctttctggctcagctcaggaagtacttcaacatgcgagtgttccgccaacgcact
taccgcatctgggccttcggaattgctgctgctgcccttggctactttgttccctatgta
cacctgatgaagtatgtggaggaggagttctcagaaatcaaggagacctgggtgctcttg
gtgtgtattggggctacctcaggccttgggcgtcttgtgtcaggccacatcagtgactcc
atccctggacttaagaagatctacttgcaggtcctttccttcctgctcctgggcctgatg
tccatgatgattcccctgtgccgggacttcgggggccttatcgtcgtctgtcttttcctg
ggcctttgcgatggcttcttcatcaccatcatggcccccattgcatttgagctggtgggc
ccaatgcaggcctcacaggccattggctacctcctgggcatgatggccctgccaatgatt
gctgggccccccattgcaggcctactccgcaactgttttggggactaccatgtggccttc
tactttgccggtgtgccccccatcatcggggctgtaatcctcttcttcgtccctctgatg
catcaaaggatgttcaagaaagagcagagagattccagcaaggataagatgttggcccct
gacccagaccccaatggggagctactgccgggctcccccaaccctgaggaaccaatctaa

DBGET integrated database retrieval system