KEGG   Homo sapiens (human): 1173Help
Entry
1173              CDS       T01001                                 

Gene name
AP2M1, AP50, CLAPM1, mu2
Definition
(RefSeq) adaptor related protein complex 2 subunit mu 1
  KO
K11826  AP-2 complex subunit mu-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1173 (AP2M1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1173 (AP2M1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1173 (AP2M1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    1173 (AP2M1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1173 (AP2M1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    1173 (AP2M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s muHD
Motif
Other DBs
NCBI-GeneID: 1173
NCBI-ProteinID: NP_004059
OMIM: 601024
HGNC: 564
Ensembl: ENSG00000161203
Vega: OTTHUMG00000156822
Pharos: Q96CW1(Tbio)
UniProt: Q96CW1
LinkDB All DBs
Structure
PDB: 

Position
3q27.1
AA seq 435 aa AA seqDB search
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS
IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG
MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattggaggcttattcatctataatcacaagggggaggtgctcatctcccgagtctac
cgagatgacatcgggaggaacgcagtggatgcctttcgggtcaatgttatccatgcccgg
cagcaggtgcgcagccccgtcaccaacattgctcgcaccagcttcttccacgttaagcgg
tccaacatttggctggcagcagtcaccaagcagaatgtcaacgctgccatggtcttcgaa
ttcctctataagatgtgtgacgtgatggctgcctactttggcaagatcagcgaggaaaac
atcaagaacaattttgtgctcatatatgagctgctggatgagattctagactttggctac
ccacagaattccgagacaggcgcgctgaaaaccttcatcacgcagcagggcatcaagagt
cagcatcagacaaaagaagagcagtcacagatcaccagccaggtaactgggcagattggc
tggcggcgagagggtatcaagtatcgtcggaatgagctcttcctggatgtgctggagagt
gtgaacctgctcatgtccccacaagggcaggtgctgagtgcccatgtgtcgggccgggtg
gtgatgaagagctacctgagtggcatgcctgaatgcaagtttgggatgaatgacaagatt
gttattgaaaagcagggcaaaggcacagctgatgaaacaagcaagagcgggaagcaatca
attgccattgatgactgcaccttccaccagtgtgtgcgactcagcaagtttgactctgaa
cgcagcatcagctttatcccgccagatggagagtttgagcttatgaggtatcgcacaacc
aaggacatcatccttcccttccgggtgatcccgctagtgcgagaagtgggacgcaccaaa
ctggaggtcaaggtggtcatcaagtccaactttaaaccctcactgctggctcagaagatc
gaggtgaggatcccaaccccactgaacacaagcggggtgcaggtgatctgcatgaagggg
aaggccaagtacaaggccagcgagaatgccatcgtgtggaagatcaagcgcatggcaggc
atgaaggaatcgcagatcagcgcagagattgagcttctgcctaccaacgacaagaagaaa
tgggctcgaccccccatttccatgaactttgaggtgccattcgcgccctctggcctcaag
gtgcgctacttgaaggtgtttgaaccgaagctgaactacagcgaccatgatgtcatcaaa
tgggtgcgctacattggccgcagtggcatttatgaaactcgctgctag

KEGG   Homo sapiens (human): 1175Help
Entry
1175              CDS       T01001                                 

Gene name
AP2S1, AP17, CLAPS2, FBH3, FBHOk, HHC3
Definition
(RefSeq) adaptor related protein complex 2 subunit sigma 1
  KO
K11827  AP-2 complex subunit sigma-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
Disease
H02026  Familial hypocalciuric hypercalcemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    1175 (AP2S1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1175 (AP2S1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    1175 (AP2S1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    1175 (AP2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1175 (AP2S1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    1175 (AP2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s Recep_L_domain
Motif
Other DBs
NCBI-GeneID: 1175
NCBI-ProteinID: NP_004060
OMIM: 602242
HGNC: 565
Ensembl: ENSG00000042753
Vega: OTTHUMG00000183437
Pharos: P53680(Tbio)
UniProt: P53680
LinkDB All DBs
Position
19q13.32
AA seq 142 aa AA seqDB search
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctttatcctcatccagaaccgggcaggcaagacgcgcctggccaagtggtac
atgcagtttgatgatgatgagaaacagaagctgatcgaggaggtgcatgccgtggtcacc
gtccgagacgccaaacacaccaactttgtggagttccggaactttaagatcatttaccgc
cgctatgctggcctctacttctgcatctgtgtggatgtcaatgacaacaacctggcttac
ctggaggccattcacaacttcgtggaggtcttaaacgaatatttccacaatgtctgtgaa
ctggacctggtgttcaacttctacaaggtttacacggtcgtggacgagatgttcctggct
ggcgaaatccgagagaccagccagacgaaggtgctgaaacagctgctgatgctacagtcc
ctggagtga

KEGG   Homo sapiens (human): 160Help
Entry
160               CDS       T01001                                 

Gene name
AP2A1, ADTAA, AP2-ALPHA, CLAPA1
Definition
(RefSeq) adaptor related protein complex 2 subunit alpha 1
  KO
K11824  AP-2 complex subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    160 (AP2A1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    160 (AP2A1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    160 (AP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    160 (AP2A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    160 (AP2A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    160 (AP2A1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    160 (AP2A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   160 (AP2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 RIX1 Dymeclin
Motif
Other DBs
NCBI-GeneID: 160
NCBI-ProteinID: NP_055018
OMIM: 601026
HGNC: 561
Ensembl: ENSG00000196961
Vega: OTTHUMG00000183253
Pharos: O95782(Tbio)
UniProt: O95782
LinkDB All DBs
Position
19q13.33
AA seq 977 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNKYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMCLALHCIANVGSREMGEAFAADIPRILVAGDSMDSVKQSAALCLLRLYKASP
DLVPMGEWTARVVHLLNDQHMGVVTAAVSLITCLCKKNPDDFKTCVSLAVSRLSRIVSSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPEDAAVKGRLVECLETVLNKAQEPPKSKKV
QHSNAKNAILFETISLIIHYDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSE
FSHEAVKTHIDTVINALKTERDVSVRQRAADLLYAMCDRSNAKQIVSEMLRYLETADYAI
REEIVLKVAILAEKYAVDYSWYVDTILNLIRIAGDYVSEEVWYRVLQIVTNRDDVQGYAA
KTVFEALQAPACHENMVKVGGYILGEFGNLIAGDPRSSPPVQFSLLHSKFHLCSVATRAL
LLSTYIKFINLFPETKATIQGVLRAGSQLRNADVELQQRAVEYLTLSSVASTDVLATVLE
EMPPFPERESSILAKLKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADL
LGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSELEPPAPESPMALLA
DPAPAADPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFRQNLGRMYLFY
GNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLL
SVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMD
AEVTKAKLLGFGSALLDNVDPNPENFVGAGIIQTKALQVGCLLRLEPNAQAQMYRLTLRT
SKEPVSRHLCELLAQQF
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgtccaagggcgatgggatgcgggggctcgcggtgttcatctccgacatc
cggaactgtaagagcaaagaggcggaaattaagagaatcaacaaggaactggccaacatc
cgctccaagttcaaaggagacaaagccttggatggctacagtaagaaaaaatatgtgtgt
aaactgcttttcatcttcctgcttggccatgacattgactttgggcacatggaggctgtg
aatctgttgagttccaataaatacacagagaagcaaataggttacctgttcatttctgtg
ctggtgaactcgaactcggagctgatccgcctcatcaacaacgccatcaagaatgacctg
gccagccgcaaccccaccttcatgtgcctggccctgcactgcatcgccaacgtgggcagc
cgggagatgggcgaggcctttgccgctgacatcccccgcatcctggtggccggggacagc
atggacagtgtcaagcagagtgcggccctgtgcctccttcgactgtacaaggcctcgcct
gacctggtgcccatgggcgagtggacggcgcgtgtggtacacctgctcaatgaccagcac
atgggtgtggtcacggccgccgtcagcctcatcacctgtctctgcaagaagaacccagat
gacttcaagacgtgcgtctctctggctgtgtcgcgcctgagccggatcgtctcctctgcc
tccaccgacctccaggactacacctactacttcgtcccagcaccctggctctcggtgaag
ctcctgcggctgctgcagtgctacccgcctccagaggatgcggctgtgaaggggcggctg
gtggaatgtctggagactgtgctcaacaaggcccaggagccccccaaatccaagaaggtg
cagcattccaacgccaagaacgccatcctcttcgagaccatcagcctcatcatccactat
gacagtgagcccaacctcctggttcgggcctgcaaccagctgggccagttcctgcagcac
cgggagaccaacctgcgctacctggccctggagagcatgtgcacgctggccagctccgag
ttctcccatgaagccgtcaagacgcacattgacaccgtcatcaatgccctcaagacggag
cgggacgtcagcgtgcggcagcgggcggctgacctcctctacgccatgtgtgaccggagc
aatgccaagcagatcgtgtcggagatgctgcggtacctggagacggcagactacgccatc
cgcgaggagatcgtcctgaaggtggccatcctggccgagaagtacgccgtggactacagc
tggtacgtggacaccatcctcaacctcatccgcattgcgggcgactacgtgagtgaggag
gtgtggtaccgtgtgctacagatcgtcaccaaccgtgatgacgtccagggctatgccgcc
aagaccgtctttgaggcgctccaggcccctgcctgtcacgagaacatggtgaaggttggc
ggctacatccttggggagtttgggaacctgattgctggggacccccgctccagcccccca
gtgcagttctccctgctccactccaagttccatctgtgcagcgtggccacgcgggcgctg
ctgctgtccacctacatcaagttcatcaacctcttccccgagaccaaggccaccatccag
ggcgtcctgcgggccggctcccagctgcgcaatgctgacgtggagctgcagcagcgagcc
gtggagtacctcaccctcagctcagtggccagcaccgacgtcctggccacggtgctggag
gagatgccgcccttccccgagcgcgagtcgtccatcctggccaagctgaaacgcaagaag
gggccaggggccggcagcgccctggacgatggccggagggaccccagcagcaacgacatc
aacgggggcatggagcccacccccagcactgtgtcgacgccctcgccctccgccgacctc
ctggggctgcgggcagcccctcccccggcagcacccccggcttctgcaggagcagggaac
cttctggtggacgtcttcgatggcccggccgcccagcccagcctggggcccacccccgag
gaggccttcctcagcgagctggagccgcctgcccccgagagccccatggctttgctggct
gacccagctccagctgctgacccaggtcctgaggacatcggccctcccattccggaagcc
gatgagttgctgaataagtttgtgtgtaagaacaacggggtcctgttcgagaaccagctg
ctgcagatcggagtcaagtcagagttccgacagaacctgggccgcatgtatctcttctat
ggcaacaagacctcggtgcagttccagaatttctcacccactgtggttcacccgggagac
ctccagactcagctggctgtgcagaccaagcgcgtggcggcgcaggtggacggcggcgcg
caggtgcagcaggtgctcaatatcgagtgcctgcgggacttcctgacgcccccgctgctg
tccgtgcgcttccggtacggtggcgccccccaggccctcaccctgaagctcccagtgacc
atcaacaagttcttccagcccaccgagatggcggcccaggatttcttccagcgctggaag
cagctgagcctccctcaacaggaggcgcagaaaatcttcaaagccaaccaccccatggac
gcagaagttactaaggccaagcttctggggtttggctctgctctcctggacaatgtggac
cccaaccctgagaacttcgtgggggcggggatcatccagactaaagccctgcaggtgggc
tgtctgcttcggctggagcccaatgcccaggcccagatgtaccggctgaccctgcgcacc
agcaaggagcccgtctcccgtcacctgtgtgagctgctggcacagcagttctga

KEGG   Homo sapiens (human): 161Help
Entry
161               CDS       T01001                                 

Gene name
AP2A2, ADTAB, CLAPA2, HIP-9, HIP9, HYPJ
Definition
(RefSeq) adaptor related protein complex 2 subunit alpha 2
  KO
K11824  AP-2 complex subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    161 (AP2A2)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    161 (AP2A2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    161 (AP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    161 (AP2A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    161 (AP2A2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    161 (AP2A2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    161 (AP2A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   161 (AP2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptin_C Alpha_adaptinC2 Cnd1 HEAT_2 DRIM RIX1 Dymeclin
Motif
Other DBs
NCBI-GeneID: 161
NCBI-ProteinID: NP_036437
OMIM: 607242
HGNC: 562
Ensembl: ENSG00000183020
Vega: OTTHUMG00000165627
Pharos: O94973(Tbio)
UniProt: O94973
LinkDB All DBs
Position
11p15.5
AA seq 939 aa AA seqDB search
MPAVSKGDGMRGLAVFISDIRNCKSKEAEIKRINKELANIRSKFKGDKALDGYSKKKYVC
KLLFIFLLGHDIDFGHMEAVNLLSSNRYTEKQIGYLFISVLVNSNSELIRLINNAIKNDL
ASRNPTFMGLALHCIASVGSREMAEAFAGEIPKVLVAGDTMDSVKQSAALCLLRLYRTSP
DLVPMGDWTSRVVHLLNDQHLGVVTAATSLITTLAQKNPEEFKTSVSLAVSRLSRIVTSA
STDLQDYTYYFVPAPWLSVKLLRLLQCYPPPDPAVRGRLTECLETILNKAQEPPKSKKVQ
HSNAKNAVLFEAISLIIHHDSEPNLLVRACNQLGQFLQHRETNLRYLALESMCTLASSEF
SHEAVKTHIETVINALKTERDVSVRQRAVDLLYAMCDRSNAPQIVAEMLSYLETADYSIR
EEIVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRVIQIVINRDDVQGYAAK
TVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFHLLHSKFHLCSVPTRALL
LSTYIKFVNLFPEVKPTIQDVLRSDSQLRNADVELQQRAVEYLRLSTVASTDILATVLEE
MPPFPERESSILAKLKKKKGPSTVTDLEDTKRDRSVDVNGGPEPAPASTSAVSTPSPSAD
LLGLGAAPPAPAGPPPSSGGSGLLVDVFSDSASVVAPLAPGSEDNFARFVCKNNGVLFEN
QLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICSDDLQPNLNLQTKPVDPTVEG
GAQVQQVVNIECVSDFTEAPVLNIQFRYGGTFQNVSVQLPITLNKFFQPTEMASQDFFQR
WKQLSNPQQEVQNIFKAKHPMDTEVTKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQ
IGCLLRLEPNLQAQMYRLTLRTSKEAVSQRLCELLSAQF
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtgtccaagggggacgggatgcggggcctggcggtcttcatctcggatatc
cgcaactgtaaaagtaaagaagcagaaataaaaaggataaacaaggaactggcaaatatc
agatcaaaatttaaaggtgacaaggctcttgatggctatagtaaaaaaaagtacgtctgc
aagttgctcttcatctttctccttggtcatgacattgactttggacacatggaggctgtg
aacctgctgagttcaaacagatacacggaaaagcagatcggctaccttttcatctctgtg
ttggtgaactcaaacagtgagctgatccgcctgatcaacaacgccatcaagaatgacctg
gccagccgcaaccccaccttcatgggcctggccctgcactgcatcgccagcgtgggcagc
cgggagatggccgaggccttcgccggggagatccctaaggtcctcgtagccggagacact
atggacagcgtgaagcagagcgcggccctgtgcttgctgcgcctgtacaggacgtccccc
gatcttgtccccatgggcgactggacatcccgagtggtgcacctgctcaatgaccagcac
ttgggtgtggtaactgcagccacaagtctgatcaccactttagcacagaagaacccagaa
gagtttaaaacctccgtgtctctggctgtctctaggctaagcagaatcgtgacgtctgca
tccacagatctccaggattacacttactattttgtcccggctccctggctgtctgtcaaa
ctgctgagactgctgcagtgctacccacccccagaccctgcagtgcgaggccgcctgact
gagtgcctggagaccatcctgaacaaagcccaagaaccgcccaagtcgaagaaggtccag
cactccaacgcgaagaatgccgtgctcttcgaggccatcagcttaatcattcaccatgac
agtgagccgaacctgctcgtccgtgcctgcaaccagttgggccagtttctgcagcaccgc
gagaccaacctgcgctacctggccctggagagcatgtgcacgctggccagctctgagttc
tcccatgaggctgtcaagacgcacatcgagacggtcatcaacgccctgaagactgagcgg
gacgtgagcgtgcggcagcgggccgtggacctcctctacgccatgtgcgaccgcagcaac
gccccacagatcgtggccgagatgctgagctatctggagacagctgactactccatccga
gaagagattgtgctgaaggtcgccatcctggctgagaagtacgcggtggactacacctgg
tatgtggataccatcttgaacttgatccgaattgctggtgattacgtgagtgaagaggtg
tggtaccgagtcattcagatcgtcatcaaccgggacgacgtgcagggctacgcggccaag
actgtgttcgaggctcttcaggctcccgcgtgccacgagaacctggtcaaagtgggcggc
tacatcctgggggagtttggaaacttgatagctggagacccgagatccagcccgctgatc
cagttccacctgctgcactccaagttccacctgtgcagcgtccccacccgcgcgctgctc
ctgtccacctacatcaagttcgtgaacctcttcccggaggtgaagcccaccatccaggac
gtgctgcgcagcgacagccagctcaggaacgcagacgtggagctgcagcagcgtgctgtg
gagtacctgcggctcagcaccgtggccagcaccgacattctggcgaccgtgctggaggag
atgcccccattcccggagcgggagtcctccatcttggcaaagctcaagaagaagaagggc
cccagcacggtgacagacctggaggacaccaagcgggacaggagtgtggacgtgaacggg
ggtcctgagcctgccccagccagtaccagcgccgtgtctacgccttctccgtcggcagac
ctgctgggtctcggggctgccccccctgcccccgcgggccccccaccctcctccggcggc
agcgggctgctcgtggacgtgttctcagactcggcctctgtggtcgcgcctctcgctcct
ggctccgaagacaactttgccaggtttgtttgtaaaaacaatggtgtgttgtttgaaaac
cagctgcttcaaattggacttaagtctgaatttcggcagaatttaggtcggatgtttatc
ttttatggtaataagacctccacgcagttcctaaactttaccccaacactaatctgttca
gacgaccttcagcctaacctgaacctgcagaccaagcccgtggacccgaccgtggagggg
ggcgcgcaggtgcagcaggtggtcaacatagagtgcgtgtccgacttcacggaggcgcca
gtcctcaacattcagttcaggtatgggggcaccttccagaacgtgtctgtgcagctgccc
atcactctcaacaaattcttccagccgacagaaatggcttctcaggatttctttcaacgt
tggaagcagttgagcaatccacagcaggaagtgcagaacatcttcaaagcaaagcaccca
atggacacagaagtcaccaaagccaagatcattggatttggttctgcacttcttgaagaa
gttgatcctaatcctgcgaatttcgtgggagctggaatcatccacacgaaaaccacccag
attggatgcctgctgcgcttggagccgaacctgcaagcccagatgtaccggctcacgctg
cgcacaagtaaggaagccgtttctcagagattatgtgaattgctctcagcgcagttttag

KEGG   Homo sapiens (human): 163Help
Entry
163               CDS       T01001                                 

Gene name
AP2B1, ADTB2, AP105B, AP2-BETA, CLAPB1
Definition
(RefSeq) adaptor related protein complex 2 subunit beta 1
  KO
K11825  AP-2 complex subunit beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    163 (AP2B1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    163 (AP2B1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    163 (AP2B1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    163 (AP2B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    163 (AP2B1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    163 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Cnd1 B2-adapt-app_C HEAT_2 HEAT Alpha_adaptinC2 Arm Cnd3 RTP1_C1 TIP120 Arm_2 Sec7_N
Motif
Other DBs
NCBI-GeneID: 163
NCBI-ProteinID: NP_001273
OMIM: 601025
HGNC: 563
Ensembl: ENSG00000006125
Vega: OTTHUMG00000179924
Pharos: P63010(Tbio)
UniProt: P63010
LinkDB All DBs
Structure
PDB: 

Position
17q12
AA seq 937 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKA
KGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ
SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT
WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWIL
AELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgactgactccaagtatttcacaaccaataaaaaaggagaaatatttgaactaaaagct
gaactcaacaatgaaaagaaagaaaagagaaaggaggctgtgaagaaagtgattgctgct
atgaccgtggggaaggatgttagttctctctttccagacgtagtgaactgtatgcagact
gacaatctggaactaaagaagcttgtgtatctctacttgatgaactacgccaagagtcag
ccagacatggccatcatggctgtaaacagctttgtgaaggactgtgaagatcctaatcct
ttgattcgagccttggcagtcagaaccatggggtgcatccgggtagacaaaattacagaa
tatctctgtgagccgctccgcaagtgcttgaaggatgaggatccctatgttcggaaaaca
gcagcagtctgcgtggcaaaactccatgatatcaatgcccaaatggtggaagatcaggga
tttctggattctctacgggatctcatagcagattcaaatccaatggtggtggctaatgcc
gtagcggcattatctgaaatcagtgagtctcacccaaacagcaacttacttgatctgaac
ccacagaacattaataagctgctgacagccctgaatgaatgcactgaatggggccagatt
ttcatcctggactgcctgtctaattacaaccctaaagatgatcgggaggctcagagcatc
tgtgagcgggtaactccccggctatcccatgccaactcagcagtggtgctttcagcggta
aaagtcctaatgaagtttctagaattgttacctaaggattctgactactacaatatgctg
ctgaagaagttagcccctccacttgtcactttgctgtctggggagccagaagtgcagtat
gtcgccctgaggaacatcaacttaattgtccagaaaaggcctgaaatcttgaagcaggaa
atcaaagtcttctttgtgaagtacaatgatcccatctatgttaaactagagaagttggac
atcatgattcgtttggcatctcaagccaacattgctcaggttctggcagaactgaaagaa
tatgctacagaggtggatgttgactttgttcgaaaagctgtgcgggccattggacggtgt
gccatcaaggtggagcaatctgcagagcgctgtgtaagcacattgcttgatctaatccag
accaaagtgaattatgtggtccaagaagcaattgttgtcatcagggacatcttccgcaaa
taccccaacaagtatgaaagtatcatcgccactctgtgtgagaacttagactcgctggat
gagccagatgctcgagcagctatgatttggattgtgggagaatatgctgaaagaattgac
aatgcagatgagttactagaaagcttcctggagggttttcacgatgaaagcacccaggtg
cagctcactctgcttactgccatagtgaagctgtttctcaagaaaccatcagaaacacag
gagctagtccagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaactgaccctgttacagctaaagaagta
gtcttgtctgagaagccactgatctctgaggagacggaccttattgagccaactctgctg
gatgagctaatctgccacattggttctttggcctctgtgtatcataagcctcccaatgct
tttgtggaaggaagtcatggaattcatcgtaaacacttgccaattcatcatgggagcact
gatgcaggtgacagccctgttggcactaccactgcaacgaacctggaacagcctcaggtt
atcccctctcaaggtgatcttctaggggatcttttaaaccttgacctcggtcccccagtc
aatgtgccacaggtgtcctccatgcagatgggagcagtggatctcctaggaggaggacta
gatagtctggtgggacaatccttcatcccatcatcggtgcctgcaacctttgctccttca
cctacacctgctgtggtcagcagtggactgaatgacctgtttgaactctccacagggata
ggcatggcacctggtggatatgtggctcctaaggctgtctggctacctgcagtaaaggct
aaaggcttggagatttccggaacatttactcaccgccaagggcacatctatatggaaatg
aacttcaccaataaagctctgcagcacatgacagattttgcaatccagtttaacaaaaat
agctttggtgtcatccccagcactcctctggccatccatacaccactgatgccaaaccag
agcattgatgtctccctgcctctcaataccttgggcccagtcatgaagatggaacctctg
aataacctccaggtggctgtgaaaaacaatatcgatgtcttctacttcagctgcctcatc
ccactcaatgtgctttttgtagaagatggcaaaatggagcgccaggtcttccttgcaaca
tggaaggatattcccaatgaaaatgaacttcagtttcagattaaggaatgtcatttaaat
gctgacactgtttccagcaagttgcaaaacaacaatgtttatactattgccaagaggaat
gtggaagggcaggacatgctgtaccaatccctgaagctcactaatggcatttggattttg
gccgaactacgtatccagccaggaaaccccaattacacgctgtcactgaagtgtagagct
cctgaagtctctcaatacatctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system