KEGG   Homo sapiens (human): 117579
Entry
117579            CDS       T01001                                 

Gene name
RLN3, H3, RXN3, ZINS4, insl7
Definition
(RefSeq) relaxin 3
  KO
K22000  relaxin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    117579 (RLN3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    117579 (RLN3)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 117579
NCBI-ProteinID: NP_543140
OMIM: 606855
HGNC: 17135
Ensembl: ENSG00000171136
Vega: OTTHUMG00000181986
Pharos: Q8WXF3(Tbio)
CPD: C16123
UniProt: Q8WXF3 B2RU28
LinkDB
Position
19p13.12
AA seq 142 aa
MARYMLLLLLAVWVLTGELWPGAEARAAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAH
EAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPGVLRGSRDV
LAGLSSSCCKWGCSKSEISSLC
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccaggtacatgctgctgctgctcctggcggtatgggtgctgaccggggagctgtgg
ccgggagctgaggcccgggcagcgccttacggggtcaggctttgcggccgagaattcatc
cgagcagtcatcttcacctgcgggggctcccggtggagacgatcagacatcctggcccac
gaggctatgggagataccttcccggatgcagatgctgatgaagacagtctggcaggcgag
ctggatgaggccatggggtccagcgagtggctggccctgaccaagtcaccccaggccttt
tacagggggcgacccagctggcaaggaacccctggggttcttcggggcagccgagatgtc
ctggctggcctttccagcagctgctgcaagtgggggtgtagcaaaagtgaaatcagtagc
ctttgctag

DBGET integrated database retrieval system