KEGG   Homo sapiens (human): 118471
Entry
118471            CDS       T01001                                 

Gene name
PRAP1, PRO1195, UPA
Definition
(RefSeq) proline rich acidic protein 1
  KO
K21250  proline-rich acidic protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    118471 (PRAP1)
SSDB
Motif
Pfam: PRAP 3HBOH
Other DBs
NCBI-GeneID: 118471
NCBI-ProteinID: NP_660203
OMIM: 609776
HGNC: 23304
Ensembl: ENSG00000165828
Vega: OTTHUMG00000019312
Pharos: Q96NZ9(Tdark)
UniProt: Q96NZ9
LinkDB
Position
10q26.3
AA seq 151 aa
MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLV
VLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEED
QGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaggaggctcctcctggtcaccagcctggtggttgtgctgctgtgggaggcaggtgca
gtcccagcacccaaggtccctatcaagatgcaagtcaaacactggccctcagagcaggac
ccagagaaggcctggggcgcccgtgtggtggagcctccggagaaggacgaccagctggtg
gtgctgttccctgtccagaagccgaaactcttgaccaccgaggagaagccacgaggtcag
ggcaggggccccatccttccaggcaccaaggcctggatggagaccgaggacaccctgggc
catgtcctgagtcccgagcccgaccatgacagcctgtaccaccctccgcctgaggaggac
cagggcgaggagaggccccggttgtgggtgatgccaaatcaccaggtgctcctgggaccg
gaggaagaccaagaccacatctaccacccccagtag

DBGET integrated database retrieval system