KEGG   Homo sapiens (human): 118788
Entry
118788            CDS       T01001                                 

Gene name
PIK3AP1, BCAP
Definition
(RefSeq) phosphoinositide-3-kinase adaptor protein 1
  KO
K12230  phosphoinositide 3-kinase adapter protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    118788 (PIK3AP1)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    118788 (PIK3AP1)
SSDB
Motif
Pfam: DBB TIR_3 OmpH
Other DBs
NCBI-GeneID: 118788
NCBI-ProteinID: NP_689522
OMIM: 607942
HGNC: 30034
Ensembl: ENSG00000155629
Vega: OTTHUMG00000018838
Pharos: Q6ZUJ8(Tdark)
UniProt: Q6ZUJ8 Q86YV3
LinkDB
Structure
PDB: 
5FOR

Position
10q24.1
AA seq 805 aa
MAASGVPRGCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQKILTHRLGPEASFSAEDLSL
FLSTRCVVVLLSAELVQHFHKPALLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAH
WQELTCDDEPETYVAAVKKAISEDSGCDSVTDTEPEDEKVVSYSKQQNLPTVTSPGNLMV
VQPDRIRCGAETTVYVIVRCKLDDRVATEAEFSPEDSPSVRMEAKVENEYTISVKAPNLS
SGNVSLKIYSGDLVVCETVISYYTDMEEIGNLLSNAANPVEFMCQAFKIVPYNTETLDKL
LTESLKNNIPASGLHLFGINQLEEEDMMTNQRDEELPTLLHFAAKYGLKNLTALLLTCPG
ALQAYSVANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDMLKSHIKEELMHGEEADAVYE
SMAHLSTDLLMKCSLNPGCDEDLYESMAAFVPAATEDLYVEMLQASTSNPIPGDGFSRAT
KDSMIRKFLEGNSMGMTNLERDQCHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETT
APGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGM
KTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRR
QREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWKTDSTS
STASSTSNRSSTRSLLSVSSGMEGDNEDNEVPEVTRSRSPGPPQVDGTPTMSLERPPRVP
PRAASQRPPTRETFHPPPPVPPRGR
NT seq 2418 nt   +upstreamnt  +downstreamnt
atggcagcctcaggggtgcccagaggatgcgacatcctcatcgtctacagcccggatgcc
gaggaatggtgccagtacctgcagaccctgttcctgtccagtcggcaggtccgcagccag
aagatactgactcacaggctgggccccgaggcctccttctcggcagaggacctaagcctt
ttcctcagcacccgctgtgtcgtggtgctgctgtccgcggagctggtgcagcacttccac
aagcccgccttgctgcccctgctgcagagagctttccatcctccgcaccgcgtggtcagg
ctgctctgcggcgtgcgggacagcgaggagttcctagacttctttccagattgggcccat
tggcaggagctcacctgtgacgatgagccagagacctacgtggcagctgtgaaaaaagcc
atttccgaagattctggctgtgactcagtcactgacactgagcctgaggacgagaaggtt
gtttcctactcgaagcagcagaacctgccgacggtgacttcacctgggaacctgatggtg
gtgcagccggaccgcattcgctgtggggcagaaaccactgtctatgttattgtgagatgt
aagctggatgacagggtggcgacagaagcagagttttctcctgaggattctccctctgta
aggatggaagccaaggtggagaatgagtacaccatttcagtgaaggctcccaacctttca
tctgggaacgtttctctgaagatatattctggagacttagtggtgtgtgaaaccgttatc
agctattatactgacatggaagaaattgggaatttattgtccaatgccgcgaatcctgtg
gaattcatgtgtcaggcctttaaaattgtgccctacaacacagagacccttgataaactg
ctaaccgaatccctgaagaacaatatccctgcaagcggactgcacctctttggaatcaac
cagctggaagaagaagatatgatgacaaatcagagggatgaagagctgcccaccctgttg
cattttgctgcgaagtatggactgaagaacctcactgccttgttgctcacctgcccagga
gccctgcaggcgtacagcgtggccaacaagcatggccactaccccaacaccatcgctgag
aaacacggcttcagggacctgcggcagttcatcgacgagtatgtggaaacggtggacatg
ctcaagagtcacattaaagaggaactgatgcacggggaggaggctgatgctgtgtacgag
tccatggcccacctttccacagacctgcttatgaaatgctcgctcaaccccggctgtgac
gaggatctctatgagtccatggctgcctttgtcccagctgccactgaagacctctatgtt
gaaatgcttcaggccagtacatctaacccaatccctggagatggtttctctcgggccact
aaggactctatgatccgcaagtttttagaaggcaacagcatgggaatgaccaatctggag
agagatcagtgccatcttggtcaggaagaagatgtttatcacacggtggatgacgatgag
gccttttctgtggacctggccagcaggccccctgtcccagtgcccagaccagagaccact
gctcctggtgctcaccagctgcctgacaacgaaccatacatttttaaagtttttgcagaa
aaaagtcaagagcggcctgggaatttctacgtttcctcagagagcatcaggaaagggccg
cccgtcagaccatggagggacaggccccagtcgagtatatatgacccttttgcgggaatg
aaaacgccaggccagcggcagcttatcaccctccaggagcaggtgaagctgggcattgtc
aacgtggatgaggctgtgctccacttcaaagagtggcagctcaaccagaagaaacgatcg
gagtcctttcgtttccagcaggaaaatcttaaacggctaagagacagcatcacccgaaga
cagagagagaagcaaaaatcaggaaagcagacagacttggagatcacggtcccaattcgg
cactcacagcacctgcctgcaaaagtggagtttggagtctatgagagtggccccaggaaa
agtgtcattccccctaggacggagctgagacgaggagactggaaaacagacagcacctcc
agcacagcaagtagcacaagtaaccgctccagcacccggagcctcctcagtgtgagcagc
gggatggaaggggacaacgaggataatgaagtccctgaggttaccagaagtcgcagtcca
ggccccccacaagtggatgggacacccaccatgtccctcgagagaccccccagggtgcct
ccgagagctgcctcacagaggcctccgaccagggagaccttccatcctcctccacctgtt
ccacccagaggacgctga

DBGET integrated database retrieval system