KEGG   Homo sapiens (human): 1188
Entry
1188              CDS       T01001                                 

Gene name
CLCNKB, CLCKB, ClC-K2, ClC-Kb
Definition
(RefSeq) chloride voltage-gated channel Kb
  KO
K05018  chloride channel Kb
Organism
hsa  Homo sapiens (human)
Pathway
hsa04966  Collecting duct acid secretion
Disease
H00239  Bartter syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    1188 (CLCNKB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1188 (CLCNKB)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel (CLC)
   1188 (CLCNKB)
SSDB
Motif
Pfam: Voltage_CLC CBS Flavi_NS4A Beta-lactamase
Other DBs
NCBI-GeneID: 1188
NCBI-ProteinID: NP_000076
OMIM: 602023
HGNC: 2027
Ensembl: ENSG00000184908
Vega: OTTHUMG00000009530
Pharos: P51801(Tbio)
UniProt: P51801 A8K8H0
LinkDB
Position
1p36.13
AA seq 687 aa
MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDWYFLMTLGVLM
ALVSCAMDLAVESVVRAHQWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPSSGG
SGIPEVKTMLAGVVLEDYLDIKNFGAKVVGLSCTLACGSTLFLGKVGPFVHLSVMMAAYL
GRVRTTTIGEPENKSKQNEMLVAAAAVGVATVFAAPFSGVLFSIEVMSSHFSVWDYWRGF
FAATCGAFMFRLLAVFNSEQETITSLYKTSFRVDVPFDLPEIFFFVALGGLCGILGSAYL
FCQRIFFGFIRNNRFSSKLLATSKPVYSALATLVLASITYPPSAGRFLASRLSMKQHLDS
LFDNHSWALMTQNSSPPWPEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIP
MPAGYFMPIFVYGAAIGRLFGETLSFIFPEGIVAGGITNPIMPGGYALAGAAAFSGAVTH
TISTALLAFEVTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTVIVKKLPYLPRILGRNI
GSHRVRVEHFMNHSITTLAKDMPLEEVVKVVTSTDVAKYPLVESTESQILVGIVRRAQLV
QALKAEPPSWAPGHQQCLQDILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTS
RGRAVGCVSWVEMKKAISNLTNPPAPK
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggaggagtttgtggggctgcgtgaaggctcctcagggaaccctgtgactctgcaggag
ctgtggggcccctgtccccgcatccgccgaggcatccgaggtggcctggagtggctgaag
cagaagctcttccgcctgggcgaggactggtacttcctgatgaccctcggggtgctcatg
gccctggtcagctgtgccatggacttggctgttgagagtgtggtccgagcgcaccagtgg
ctgtacagggagattggggacagccacctgctccggtatctctcctggactgtgtaccct
gtggccctcgtctctttctcttcaggcttctctcagagcatcacaccctcctctggaggt
tctggaatcccggaggtgaagaccatgttggcgggtgtggtcttggaggactacctggat
atcaagaactttggggccaaagtggtgggcctctcctgcaccctggcctgtggcagcacc
ctcttcctcgggaaagtgggccctttcgtgcacctgtctgtgatgatggctgcctacctg
ggccgtgtgcgcaccacgaccatcggggagcctgagaacaagagcaagcaaaacgaaatg
ctggtggcagcggcggcagtgggcgtggccacagtctttgcagctcccttcagcggcgtc
ctgttcagcatcgaggtcatgtcttcccacttctctgtctgggattactggaggggcttc
tttgcggccacctgcggggccttcatgttccggctcctggcggtcttcaacagcgagcag
gagaccatcacctccctctacaagaccagtttccgggtggacgttcccttcgacctgcct
gagatcttcttttttgtggcgctggggggtctctgtggcatcctgggcagcgcttacctc
ttctgtcagcgaatcttctttggcttcatcaggaacaataggttcagctccaaactgctg
gccaccagcaagcctgtgtactccgctctggccaccttggttctcgcctccatcacctac
ccacccagcgccggccgcttcctagcttctcggctgtccatgaagcagcatctggactcg
ctgttcgacaaccactcctgggcgctgatgacccagaactccagcccaccctggcccgag
gagctcgacccccagcacctgtggtgggaatggtaccacccgcggttcaccatctttggg
acccttgccttcttcctggttatgaagttctggatgctgattctggccaccaccatcccc
atgcctgccgggtacttcatgcccatctttgtctatggagctgctatcgggcgcctcttt
ggggagactctctcttttatcttccctgagggcatcgtggctggagggatcaccaatccc
atcatgccaggggggtatgctctggcaggggctgcagccttctcaggggctgtgacccac
accatctccacggcgctgctggccttcgaggtgaccggccagatagtgcatgcactgccc
gtgctgatggcggtgctggcagccaacgccattgcacagagctgccagccctccttctat
gatggcaccgtcattgtcaagaagctgccatacctgccacggattctgggccgcaacatc
ggttcccaccgcgtgagggtggagcacttcatgaaccacagcatcaccacactggccaag
gacatgccactggaggaggtggtcaaggttgtgacctccacagacgtggccaagtatccc
ctggtggagagcacagagtcccagatcctggtgggcatagtgcgaagggcccagctggtg
caggccctgaaggctgagcctccttcctgggctcctggacaccagcagtgtctccaggac
atcttggctgcaggctgccccacagaaccagtgaccctgaagctgtccccagagacttcc
ctgcatgaggcacacaacctctttgagctgttgaaccttcattccctctttgtgacgtcg
cggggcagagctgtgggctgcgtgtcctgggtggagatgaagaaagcaatttccaacctg
acaaatccgccagccccaaagtga

DBGET integrated database retrieval system