KEGG   Homo sapiens (human): 119391Help
Entry
119391            CDS       T01001                                 

Gene name
GSTO2, GSTO_2-2, bA127L20.1
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    119391 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    119391 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    119391 (GSTO2)
   00983 Drug metabolism - other enzymes
    119391 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    119391 (GSTO2)
   05204 Chemical carcinogenesis
    119391 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    119391 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    119391 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    119391 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    119391 (GSTO2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     119391 (GSTO2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   119391 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 119391
NCBI-ProteinID: NP_899062
OMIM: 612314
HGNC: 23064
Ensembl: ENSG00000065621
Vega: OTTHUMG00000019006
Pharos: Q9H4Y5(Tbio)
UniProt: Q9H4Y5
LinkDB All DBs
Structure
PDB: 

Position
10q25.1
AA seq 243 aa AA seqDB search
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKP
EWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWP
WFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDF
GLC
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggatgcgaccaggaccctggggaaaggaagccagcccccagggccagtcccg
gaggggctgatccgcatctacagcatgaggttctgcccctattctcacaggacccgcctc
gtcctcaaggccaaagacatcagacatgaagtggtcaacattaacctgagaaacaagcct
gaatggtactatacaaagcacccttttggccacattcctgtcctggagaccagccaatgt
caactgatctatgaatctgttattgcttgtgagtacctggatgatgcttatccaggaagg
aagctgtttccatatgacccttatgaacgagctcgccaaaagatgttattggagctattt
tgtaaggtcccacatttgaccaaggagtgcctggtagcgttgagatgtgggagagaatgc
actaatctgaaggcagccctgcgtcaggaattcagcaacctggaagagattcttgagtat
cagaacaccaccttctttggtggaacctgtatatccatgattgattacctcctctggccc
tggtttgagcggctggatgtgtatgggatactggactgtgtgagccacacgccagccctg
cggctctggatatcagccatgaagtgggaccccacagtctgtgctcttctcatggataag
agcattttccagggcttcttgaatctctattttcagaacaaccctaatgcctttgacttt
gggctgtgctga

KEGG   Homo sapiens (human): 221357Help
Entry
221357            CDS       T01001                                 

Gene name
GSTA5
Definition
(RefSeq) glutathione S-transferase alpha 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    221357 (GSTA5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    221357 (GSTA5)
   00982 Drug metabolism - cytochrome P450
    221357 (GSTA5)
   00983 Drug metabolism - other enzymes
    221357 (GSTA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    221357 (GSTA5)
   05204 Chemical carcinogenesis
    221357 (GSTA5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    221357 (GSTA5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    221357 (GSTA5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    221357 (GSTA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    221357 (GSTA5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     221357 (GSTA5)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   221357 (GSTA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 221357
NCBI-ProteinID: NP_714543
OMIM: 607605
HGNC: 19662
Ensembl: ENSG00000182793
Vega: OTTHUMG00000014857
Pharos: Q7RTV2(Tdark)
UniProt: Q7RTV2
LinkDB All DBs
Position
6p12.2
AA seq 222 aa AA seqDB search
MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDAK
TALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSQRKPPMDEKSLEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactactccaatgcacggggcagtatggagtccattcgg
tggctcctggctgcagctggagtagagttggaagagaaatttctagaatctgcagaagat
ttggacaagttaagaaatgatgggagtttgctgttccagcaagtaccaatggttgagatt
gacgggatgaagctggtgcagaccagagccattcttaactacattgccagcaaatacaac
ctttatgggaaagacatgaaggagagagccctgattgatatgtacacagaaggtatagta
gatttgactgaaatgatccttcttctgctcatatgtcaaccagaggaaagagatgccaag
actgccttggtcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccacagacaagactaccttgttggcaacaagctgagctgggctgacattcacctg
gtggaacttttctactacgtggaagagcttgactcgagtcttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctgcagcct
ggcagccagagaaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc
aggttttaa

KEGG   Homo sapiens (human): 2938Help
Entry
2938              CDS       T01001                                 

Gene name
GSTA1, GST-epsilon, GST2, GSTA1-1, GTH1
Definition
(RefSeq) glutathione S-transferase alpha 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2938 (GSTA1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2938 (GSTA1)
   00982 Drug metabolism - cytochrome P450
    2938 (GSTA1)
   00983 Drug metabolism - other enzymes
    2938 (GSTA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2938 (GSTA1)
   05204 Chemical carcinogenesis
    2938 (GSTA1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2938 (GSTA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2938 (GSTA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2938 (GSTA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2938 (GSTA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2938 (GSTA1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2938 (GSTA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2938
NCBI-ProteinID: NP_665683
OMIM: 138359
HGNC: 4626
Ensembl: ENSG00000243955
Vega: OTTHUMG00000014861
Pharos: P08263(Tchem)
UniProt: P08263 A0A140VJK4
LinkDB All DBs
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK
LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactacttcaatgcacggggcagaatggagtccacccgg
tggctcctggctgcagctggagtagagtttgaagagaaatttataaaatctgcagaagat
ttggacaagttaagaaatgatggatatttgatgttccagcaagtgccaatggttgagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac
ctctatgggaaagacataaaggagagagccctgattgatatgtatatagaaggtatagca
gatttgggtgaaatgatcctccttctgcccgtatgtccacctgaggaaaaagatgccaag
cttgccttgatcaaagagaaaataaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccatggacaagactaccttgttggcaacaagctgagccgggctgacattcatctg
gtggaacttctctactacgtcgaggagcttgactccagtcttatctccagcttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacagtgaagaagtttctacagcct
ggcagcccaaggaagcctcccatggatgagaaatctttagaagaagcaaggaagattttc
aggttttaa

KEGG   Homo sapiens (human): 2939Help
Entry
2939              CDS       T01001                                 

Gene name
GSTA2, GST2, GSTA2-2, GTA2, GTH2
Definition
(RefSeq) glutathione S-transferase alpha 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2939 (GSTA2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2939 (GSTA2)
   00982 Drug metabolism - cytochrome P450
    2939 (GSTA2)
   00983 Drug metabolism - other enzymes
    2939 (GSTA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2939 (GSTA2)
   05204 Chemical carcinogenesis
    2939 (GSTA2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2939 (GSTA2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2939 (GSTA2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2939 (GSTA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2939 (GSTA2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2939 (GSTA2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2939 (GSTA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3
Motif
Other DBs
NCBI-GeneID: 2939
NCBI-ProteinID: NP_000837
OMIM: 138360
HGNC: 4627
Ensembl: ENSG00000244067
Vega: OTTHUMG00000016263
Pharos: P09210(Tbio)
UniProt: P09210 A0A140VKE2 A8K987
LinkDB All DBs
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAK
LALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagcccaagctccactactccaatatacggggcagaatggagtccatccgg
tggctcctggctgcagctggagtagagtttgaagagaaatttataaaatctgcagaagat
ttggacaagttaagaaatgatggatatttgatgttccagcaagtgccaatggttgagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccagcaaatacaac
ctctatgggaaagacataaaggagaaagccctgattgatatgtatatagaaggtatagca
gatttgggtgaaatgatccttcttctgccctttagtcaacctgaggaacaagatgccaag
cttgccttgatccaagagaaaacaaaaaatcgctacttccctgcctttgaaaaagtctta
aagagccacggacaagactaccttgttggcaacaagctgagccgggctgacattcacctg
gtggaacttctctactacgtggaagagcttgactctagccttatttccagcttccctctg
ctgaaggccctgaaaaccagaatcagtaacctgcccacagtgaagaagtttctacagcct
ggcagcccaaggaagcctcccatggatgagaaatctttagaagaatcaaggaagattttc
aggttttaa

KEGG   Homo sapiens (human): 2940Help
Entry
2940              CDS       T01001                                 

Gene name
GSTA3, GSTA3-3, GTA3
Definition
(RefSeq) glutathione S-transferase alpha 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2940 (GSTA3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2940 (GSTA3)
   00982 Drug metabolism - cytochrome P450
    2940 (GSTA3)
   00983 Drug metabolism - other enzymes
    2940 (GSTA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2940 (GSTA3)
   05204 Chemical carcinogenesis
    2940 (GSTA3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2940 (GSTA3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2940 (GSTA3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2940 (GSTA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2940 (GSTA3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2940 (GSTA3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2940 (GSTA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C DUF3825 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2940
NCBI-ProteinID: NP_000838
OMIM: 605449
HGNC: 4628
Ensembl: ENSG00000174156
Vega: OTTHUMG00000014865
Pharos: Q16772(Tbio)
UniProt: Q16772
LinkDB All DBs
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPL
LKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaagcccaagcttcactacttcaatggacggggcagaatggagcccatccgg
tggctcttggctgcagctggagtggagtttgaagagaaatttataggatctgcagaagat
ttgggaaagttaagaaatgatgggagtttgatgttccagcaagtaccaatggttgagatt
gatgggatgaagttggtacagaccagagccattctcaactacattgccagcaaatacaac
ctctacgggaaagacataaaggagagagccctaattgatatgtatacagaaggtatggca
gatttgaatgaaatgatccttcttctgcccttatgtcgacctgaggaaaaagatgccaag
attgccttgatcaaagagaaaacaaaaagtcgctatttccctgccttcgaaaaagtgtta
cagagccatggacaagactaccttgttggcaacaagctgagccgggctgacattagcctg
gtggaacttctctactatgtggaagagcttgactccagccttatctccaacttccctctg
ctgaaggccctgaaaaccagaatcagcaacctgcccacggtgaagaagtttctacagcct
ggcagcccaaggaagcctcccgcagatgcaaaagctttagaagaagccagaaagattttc
aggttttaa

KEGG   Homo sapiens (human): 2941Help
Entry
2941              CDS       T01001                                 

Gene name
GSTA4, GSTA4-4, GTA4
Definition
(RefSeq) glutathione S-transferase alpha 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2941 (GSTA4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2941 (GSTA4)
   00982 Drug metabolism - cytochrome P450
    2941 (GSTA4)
   00983 Drug metabolism - other enzymes
    2941 (GSTA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2941 (GSTA4)
   05204 Chemical carcinogenesis
    2941 (GSTA4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2941 (GSTA4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2941 (GSTA4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2941 (GSTA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2941 (GSTA4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2941 (GSTA4)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2941 (GSTA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_2 CbeA_antitoxin GST_N_3
Motif
Other DBs
NCBI-GeneID: 2941
NCBI-ProteinID: NP_001503
OMIM: 605450
HGNC: 4629
Ensembl: ENSG00000170899
Vega: OTTHUMG00000014868
Pharos: O15217(Tbio)
UniProt: O15217 A0A024RD58
LinkDB All DBs
Structure
PDB: 

Position
6p12.2
AA seq 222 aa AA seqDB search
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPF
LQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaggcccaagctccactatcccaacggaagaggccggatggagtccgtgaga
tgggttttagctgccgccggagtcgagtttgatgaagaatttctggaaacaaaagaacag
ttgtacaagttgcaggatggtaaccacctgctgttccaacaagtgcccatggttgaaatt
gacgggatgaagttggtacagacccgaagcattctccactacatagcagacaagcacaat
ctctttggcaagaacctcaaggagagaaccctgattgacatgtacgtggaggggacactg
gatctgctggaactgcttatcatgcatcctttcttaaaaccagatgatcagcaaaaggaa
gtggttaacatggcccagaaggctataattagatactttcctgtgtttgaaaagatttta
aggggtcacggacaaagctttcttgttggtaatcagctgagccttgcagatgtgatttta
ctccaaaccattttagctctagaagagaaaattcctaatatcctgtctgcatttcctttc
ctccaggaatacacagtgaaactaagtaatatccctacaattaagagattccttgaacct
ggcagcaagaagaagcctccccctgatgaaatttatgtgagaaccgtctacaacatcttt
aggccataa

KEGG   Homo sapiens (human): 2944Help
Entry
2944              CDS       T01001                                 

Gene name
GSTM1, GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MU, MU-1
Definition
(RefSeq) glutathione S-transferase mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2944 (GSTM1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2944 (GSTM1)
   00982 Drug metabolism - cytochrome P450
    2944 (GSTM1)
   00983 Drug metabolism - other enzymes
    2944 (GSTM1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2944 (GSTM1)
   05204 Chemical carcinogenesis
    2944 (GSTM1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2944 (GSTM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2944 (GSTM1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2944 (GSTM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2944 (GSTM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2944 (GSTM1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2944 (GSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2944
NCBI-ProteinID: NP_000552
OMIM: 138350
HGNC: 4632
Ensembl: ENSG00000134184
Vega: OTTHUMG00000011635
Pharos: P09488(Tbio)
UniProt: P09488 X5DR03
LinkDB All DBs
Structure
PDB: 

Position
1p13.3
AA seq 218 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatactggggtactgggacatccgcgggctggcccacgccatccgcctgctc
ctggaatacacagactcaagctatgaggaaaagaagtacacgatgggggacgctcctgat
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaacgccatcttgtgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccagaccatggacaaccatatgcagctgggcatgatctgctacaatccagaattt
gagaaactgaagccaaagtacttggaggaactccctgaaaagctaaagctctactcagag
tttctggggaagcggccatggtttgcaggaaacaagatcacttttgtagattttctcgtc
tatgatgtccttgacctccaccgtatatttgagcccaagtgcttggacgccttcccaaat
ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttctcaaagatggctgtctggggcaacaagtag

KEGG   Homo sapiens (human): 2946Help
Entry
2946              CDS       T01001                                 

Gene name
GSTM2, GST4, GSTM, GSTM2-2, GTHMUS
Definition
(RefSeq) glutathione S-transferase mu 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2946 (GSTM2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2946 (GSTM2)
   00982 Drug metabolism - cytochrome P450
    2946 (GSTM2)
   00983 Drug metabolism - other enzymes
    2946 (GSTM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2946 (GSTM2)
   05204 Chemical carcinogenesis
    2946 (GSTM2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2946 (GSTM2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2946 (GSTM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2946 (GSTM2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2946 (GSTM2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2946 (GSTM2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2946 (GSTM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3 Bromo_TP GST_N_2
Motif
Other DBs
NCBI-GeneID: 2946
NCBI-ProteinID: NP_000839
OMIM: 138380
HGNC: 4634
Ensembl: ENSG00000213366
Vega: OTTHUMG00000011638
Pharos: P28161(Tchem)
UniProt: P28161 A0A384P5E9 Q0D2I8
LinkDB All DBs
Structure
PDB: 

Position
1p13.3
AA seq 218 aa AA seqDB search
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgacactggggtactggaacatccgcgggctggcccattccatccgcctgctc
ctggaatacacagactcaagctacgaggaaaagaagtacacgatgggggacgctcctgat
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatgggactcacaagatcacccagagcaacgccatcctgcggtacatt
gcccgcaagcacaacctgtgcggggaatcagaaaaggagcagattcgcgaagacattttg
gagaaccagtttatggacagccgtatgcagctggccaaactctgctatgacccagatttt
gagaaactgaaaccagaatacctgcaggcactccctgaaatgctgaagctctactcacag
tttctggggaagcagccatggtttcttggggacaagatcacctttgtggatttcatcgct
tatgatgtccttgagagaaaccaagtatttgagcccagctgcctggatgccttcccaaac
ctgaaggacttcatctcccgatttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttcacaaagatggctgtctggggcaacaagtag

KEGG   Homo sapiens (human): 2947Help
Entry
2947              CDS       T01001                                 

Gene name
GSTM3, GST5, GSTB, GSTM3-3, GTM3
Definition
(RefSeq) glutathione S-transferase mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2947 (GSTM3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2947 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    2947 (GSTM3)
   00983 Drug metabolism - other enzymes
    2947 (GSTM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2947 (GSTM3)
   05204 Chemical carcinogenesis
    2947 (GSTM3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2947 (GSTM3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2947 (GSTM3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2947 (GSTM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2947 (GSTM3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2947 (GSTM3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2947 (GSTM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2947
NCBI-ProteinID: NP_000840
OMIM: 138390
HGNC: 4635
Ensembl: ENSG00000134202
Vega: OTTHUMG00000011640
Pharos: P21266(Tbio)
UniProt: P21266 Q6FGJ9
LinkDB All DBs
Structure
PDB: 

Position
1p13.3
AA seq 225 aa AA seqDB search
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY
SSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD
EFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcgagtcgtctatggttctcgggtactgggatattcgtgggctggcgcacgcc
atccgcctgctcctggagttcacggatacctcttatgaggagaaacggtacacgtgcggg
gaagctcctgactatgatcgaagccaatggctggatgtgaaattcaagctagacctggac
tttcctaatctgccctacctcctggatgggaagaacaagatcacccagagcaatgccatc
ttgcgctacatcgctcgcaagcacaacatgtgtggtgagactgaagaagaaaagattcga
gtggacatcatagagaaccaagtaatggatttccgcacacaactgataaggctctgttac
agctctgaccacgaaaaactgaagcctcagtacttggaagagctacctggacaactgaaa
caattctccatgtttctggggaaattctcatggtttgccggggaaaagctcacctttgtg
gattttctcacctatgatatcttggatcagaaccgtatatttgaccccaagtgcctggat
gagttcccaaacctgaaggctttcatgtgccgttttgaggctttggagaaaatcgctgcc
tacttacagtctgatcagttctgcaagatgcccatcaacaacaagatggcccagtggggc
aacaagcctgtatgctga

KEGG   Homo sapiens (human): 2948Help
Entry
2948              CDS       T01001                                 

Gene name
GSTM4, GSTM4-4, GTM4
Definition
(RefSeq) glutathione S-transferase mu 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2948 (GSTM4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2948 (GSTM4)
   00982 Drug metabolism - cytochrome P450
    2948 (GSTM4)
   00983 Drug metabolism - other enzymes
    2948 (GSTM4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2948 (GSTM4)
   05204 Chemical carcinogenesis
    2948 (GSTM4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2948 (GSTM4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2948 (GSTM4)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2948 (GSTM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2948 (GSTM4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2948 (GSTM4)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2948 (GSTM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3 Bromo_TP
Motif
Other DBs
NCBI-GeneID: 2948
NCBI-ProteinID: NP_000841
OMIM: 138333
HGNC: 4636
Ensembl: ENSG00000168765
Vega: OTTHUMG00000011642
Pharos: Q03013(Tbio)
UniProt: Q03013 A0A140VKE3
LinkDB All DBs
Structure
PDB: 

Position
1p13.3
AA seq 218 aa AA seqDB search
MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDF
EKLKPEYLEELPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgacactggggtactgggacatccgcgggctggcccacgccatccgcctgctc
ctggaatacacagactcaagctacgaggaaaagaagtatacgatgggggacgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaacgccatcctgtgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccaggctatggacgtctccaatcagctggccagagtctgctacagccctgacttt
gagaaactgaagccagaatacttggaggaacttcctacaatgatgcagcacttctcacag
ttcctggggaagaggccatggtttgttggagacaagatcacctttgtagatttcctcgcc
tatgatgtccttgacctccaccgtatatttgagcccaactgcttggacgcctttccaaat
ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaaaacctctgtacacaagggtggctgtctggggcaacaagtaa

KEGG   Homo sapiens (human): 2949Help
Entry
2949              CDS       T01001                                 

Gene name
GSTM5, GSTM5-5, GTM5
Definition
(RefSeq) glutathione S-transferase mu 5
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2949 (GSTM5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2949 (GSTM5)
   00982 Drug metabolism - cytochrome P450
    2949 (GSTM5)
   00983 Drug metabolism - other enzymes
    2949 (GSTM5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2949 (GSTM5)
   05204 Chemical carcinogenesis
    2949 (GSTM5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2949 (GSTM5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2949 (GSTM5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2949 (GSTM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2949 (GSTM5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2949 (GSTM5)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2949 (GSTM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2949
NCBI-ProteinID: NP_000842
OMIM: 138385
HGNC: 4637
Ensembl: ENSG00000134201
Vega: OTTHUMG00000011644
Pharos: P46439(Tbio)
UniProt: P46439 Q5T8R2
LinkDB All DBs
Position
1p13.3
AA seq 218 aa AA seqDB search
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLN
LKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgactctggggtactgggacatccgtgggctggcccacgccatccgcttgctc
ctggaatacacagactcaagctatgtggaaaagaagtacacgctgggggacgctcctgac
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaatgccatcctgcgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccaggttatggataaccacatggagctggtcagactgtgctatgacccagatttt
gagaaactgaagccaaaatacttggaggaactccctgaaaagctaaagctctactcagag
tttctggggaagcggccatggtttgcaggagacaagatcacctttgtggatttccttgcc
tatgatgtccttgacatgaagcgtatatttgagcccaagtgcttggacgccttcctaaac
ttgaaggacttcatctcccgctttgagggtttgaagaagatctctgcctacatgaagtcc
agccaattcctccgaggtcttttgtttggaaagtcagctacatggaacagcaaatag

KEGG   Homo sapiens (human): 2950Help
Entry
2950              CDS       T01001                                 

Gene name
GSTP1, DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI
Definition
(RefSeq) glutathione S-transferase pi 1
  KO
K23790  glutathione S-transferase P [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05215  Prostate cancer
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Disease
H00024  Prostate cancer
Drug target
Ezatiostat hydrochloride: D08917
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2950 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2950 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    2950 (GSTP1)
   00983 Drug metabolism - other enzymes
    2950 (GSTP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2950 (GSTP1)
   05204 Chemical carcinogenesis
    2950 (GSTP1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2950 (GSTP1)
   05215 Prostate cancer
    2950 (GSTP1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2950 (GSTP1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2950 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2950 (GSTP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2950 (GSTP1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2950 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 2950
NCBI-ProteinID: NP_000843
OMIM: 134660
HGNC: 4638
Ensembl: ENSG00000084207
Vega: OTTHUMG00000137430
Pharos: P09211(Tchem)
UniProt: P09211 V9HWE9
LinkDB All DBs
Structure
PDB: 

Position
11q13.2
AA seq 210 aa AA seqDB search
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagatcagggccagagctggaaggaggaggtggtgaccgtggagacgtggcag
gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat
gggaaggaccagcaggaggcagccctggtggacatggtgaatgacggcgtggaggacctc
cgctgcaaatacatctccctcatctacaccaactatgaggcgggcaaggatgactatgtg
aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctagcccctggctgcctggatgcgttccccctgctctcagcatat
gtggggcgcctcagtgcccggcccaagctcaaggccttcctggcctcccctgagtacgtg
aacctccccatcaatggcaacgggaaacagtga

KEGG   Homo sapiens (human): 2952Help
Entry
2952              CDS       T01001                                 

Gene name
GSTT1
Definition
(RefSeq) glutathione S-transferase theta 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2952 (GSTT1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2952 (GSTT1)
   00982 Drug metabolism - cytochrome P450
    2952 (GSTT1)
   00983 Drug metabolism - other enzymes
    2952 (GSTT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2952 (GSTT1)
   05204 Chemical carcinogenesis
    2952 (GSTT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2952 (GSTT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2952 (GSTT1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2952 (GSTT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2952 (GSTT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2952 (GSTT1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2952 (GSTT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 2952
NCBI-ProteinID: NP_000844
OMIM: 600436
HGNC: 4641
Pharos: P30711(Tbio)
UniProt: P30711
LinkDB All DBs
Structure
PDB: 

Position
22q11.23
AA seq 240 aa AA seqDB search
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctgtacctggacctgctgtcccagccctgccgcgctgtttacatcttt
gccaagaagaacgacattcccttcgagctgcgcatcgtggatctgattaaaggtcagcac
ttaagcgatgcctttgcccaggtgaaccccctcaagaaggtgccagccttgaaggacggg
gacttcaccttgacggagagtgtggccatcctgctctacctgacgcgcaaatataaggtc
cctgactactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca
tggcagcacacgactctgcggagaagctgcctccgggccttgtggcataaggtgatgttc
cctgttttcctgggtgagccagtatctccccagacactggcagccaccctggcagagttg
gatgtgaccctgcagttgctcgaggacaagttcctccagaacaaggccttccttactggt
cctcacatctccttagctgacctcgtagccatcacggagctgatgcatcccgtgggtgct
ggctgccaagtcttcgaaggccgacccaagctggccacatggcggcagcgcgtggaggca
gcagtgggggaggacctcttccaggaggcccatgaggtcattctgaaggccaaggacttc
ccacctgcagaccccaccataaagcagaagctgatgccctgggtgctggccatgatccgg
tga

KEGG   Homo sapiens (human): 2953Help
Entry
2953              CDS       T01001                                 

Gene name
GSTT2
Definition
(RefSeq) glutathione S-transferase theta 2 (gene/pseudogene)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2953 (GSTT2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2953 (GSTT2)
   00982 Drug metabolism - cytochrome P450
    2953 (GSTT2)
   00983 Drug metabolism - other enzymes
    2953 (GSTT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2953 (GSTT2)
   05204 Chemical carcinogenesis
    2953 (GSTT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    2953 (GSTT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2953 (GSTT2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    2953 (GSTT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2953 (GSTT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2953 (GSTT2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2953 (GSTT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 2953
NCBI-ProteinID: NP_000845
OMIM: 600437
HGNC: 4642
Ensembl: ENSG00000099984
Vega: OTTHUMG00000150786
Pharos: P0CG29(Tbio)
UniProt: P0CG29
LinkDB All DBs
Structure
PDB: 

Position
22q11.23
AA seq 244 aa AA seqDB search
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcctagagctgtttcttgacctggtgtcccagcccagccgcgccgtctacatcttc
gccaagaagaatggcatccccttagagctgcgcaccgtggatttggtcaaagggcagcac
aagagcaaggagttcttgcagatcaacagcctggggaaactgccgacgctcaaggatggt
gatttcatcttgaccgaaagctcggccatcctgatttacctgagctgtaagtaccagacg
ccggaccactggtatccatctgacctgcaggctcgtgcccgtgttcatgagtacctgggc
tggcatgccgactgcatccgtggcacctttggtatacccctgtgggtccaggtgttgggg
ccactcattggggtccaggtgcccaaggagaaggtggaacgcaacaggactgccatggac
caggccctgcaatggctggaggacaagttcctgggggacaggcccttcctcgctggccag
caggtgacactggctgatctcatggccctggaggagctgatgcagccggtggctctcggc
tatgaactgtttgagggacggccacgactggcagcatggcgtggacgagtggaggctttc
ctgggtgctgagctatgccaggaggcccacagcatcatcttgagcatcctggaacaggcg
gccaagaaaaccctcccaacaccctcaccagaggcctatcaggctatgctgcttcgaatc
gccaggatcccctga

KEGG   Homo sapiens (human): 4257Help
Entry
4257              CDS       T01001                                 

Gene name
MGST1, GST12, MGST, MGST-I
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4257 (MGST1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4257 (MGST1)
   00982 Drug metabolism - cytochrome P450
    4257 (MGST1)
   00983 Drug metabolism - other enzymes
    4257 (MGST1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4257 (MGST1)
   05204 Chemical carcinogenesis
    4257 (MGST1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    4257 (MGST1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4257 (MGST1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4257 (MGST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4257 (MGST1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4257 (MGST1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   4257 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 4257
NCBI-ProteinID: NP_001247440
OMIM: 138330
HGNC: 7061
Ensembl: ENSG00000008394
Vega: OTTHUMG00000168816
Pharos: P10620(Tbio)
UniProt: P10620 A0A024RAX2
LinkDB All DBs
Position
12p12.3
AA seq 155 aa AA seqDB search
MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLTRKVFANPEDCVAFGKGENAK
KYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA
YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgacctcacccaggtaatggatgatgaagtattcatggcttttgcatcctatgca
acaattattctttcaaaaatgatgcttatgagtactgcaactgcattctatagattgaca
agaaaggtttttgccaatccagaagactgtgtagcatttggcaaaggagaaaatgccaag
aagtatcttcgaacagatgacagagtagaacgtgtacgcagagcccacctgaatgacctt
gaaaatattattccatttcttggaattggcctcctgtattccttgagtggtcccgacccc
tctacagccatcctgcacttcagactatttgtcggagcacggatctaccacaccattgca
tatttgacaccccttccccagccaaatagagctttgagtttttttgttggatatggagtt
actctttccatggcttacaggttgctgaaaagtaaattgtacctgtaa

KEGG   Homo sapiens (human): 4258Help
Entry
4258              CDS       T01001                                 

Gene name
MGST2, GST2, MGST-II
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4258 (MGST2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4258 (MGST2)
   00982 Drug metabolism - cytochrome P450
    4258 (MGST2)
   00983 Drug metabolism - other enzymes
    4258 (MGST2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4258 (MGST2)
   05204 Chemical carcinogenesis
    4258 (MGST2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    4258 (MGST2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4258 (MGST2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4258 (MGST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4258 (MGST2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4258 (MGST2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   4258 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 4258
NCBI-ProteinID: NP_001191295
OMIM: 601733
HGNC: 7063
Ensembl: ENSG00000085871
Vega: OTTHUMG00000133382
Pharos: Q99735(Tbio)
UniProt: Q99735
LinkDB All DBs
Position
4q31.1
AA seq 147 aa AA seqDB search
MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTL
LGALGIANSFLDEYLDLNIAKKLRRQF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaactcgatcctgctggctgctgtctctattctctcggcctgtcagcaaagt
tattttgctttgcaagttggaaaggcaagattaaaatacaaagttacgcccccagcagtc
actgggtcaccagagtttgagagagtatttcgggcacaacaaaactgtgtggagttttat
cctatattcataattacattgtggatggctgggtggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatatatggccgtcacctatacttctggggatattcagaagct
gctaaaaaacggatcaccggtttccgactgagtctggggattttggccttgttgaccctc
ctaggtgccctgggaattgcaaacagctttctggatgaatatctggacctcaatattgcc
aagaaactgaggcggcaattctaa

KEGG   Homo sapiens (human): 4259Help
Entry
4259              CDS       T01001                                 

Gene name
MGST3, GST-III
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4259 (MGST3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4259 (MGST3)
   00982 Drug metabolism - cytochrome P450
    4259 (MGST3)
   00983 Drug metabolism - other enzymes
    4259 (MGST3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4259 (MGST3)
   05204 Chemical carcinogenesis
    4259 (MGST3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    4259 (MGST3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4259 (MGST3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4259 (MGST3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4259 (MGST3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4259 (MGST3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   4259 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 4259
NCBI-ProteinID: NP_004519
OMIM: 604564
HGNC: 7064
Ensembl: ENSG00000143198
Vega: OTTHUMG00000034627
Pharos: O14880(Tbio)
UniProt: O14880 A0A024R8Z1
LinkDB All DBs
Position
1q24.1
AA seq 152 aa AA seqDB search
MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRA
HQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI
ALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctctctaaggaatatggttttgtgcttctaactggtgctgccagctttata
atggtggcccacctagccatcaatgtttccaaggcccgcaagaagtacaaagtggagtat
cctatcatgtacagcacggaccctgaaaatgggcacatcttcaactgcattcagcgagcc
caccagaacacgttggaagtgtatcctcccttcttattttttctagctgttggaggtgtt
taccacccgcgtatagcttctggcctgggcttggcctggattgttggacgagttctttat
gcttatggctattacacgggagaacccagcaagcgtagtcgaggagccctggggtccatc
gccctcctgggcttggtgggcacaactgtgtgctctgctttccagcatcttggttgggtt
aaaagtggcttgggcagtggacccaaatgctgccattaa

KEGG   Homo sapiens (human): 653689Help
Entry
653689            CDS       T01001                                 

Gene name
GSTT2B, GSTT2P
Definition
(RefSeq) glutathione S-transferase theta 2B (gene/pseudogene)
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    653689 (GSTT2B)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    653689 (GSTT2B)
   00982 Drug metabolism - cytochrome P450
    653689 (GSTT2B)
   00983 Drug metabolism - other enzymes
    653689 (GSTT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    653689 (GSTT2B)
   05204 Chemical carcinogenesis
    653689 (GSTT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    653689 (GSTT2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    653689 (GSTT2B)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    653689 (GSTT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    653689 (GSTT2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     653689 (GSTT2B)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   653689 (GSTT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-GeneID: 653689
NCBI-ProteinID: NP_001074312
HGNC: 33437
Ensembl: ENSG00000133433
Vega: OTTHUMG00000150774
Pharos: P0CG30(Tbio)
UniProt: P0CG30 G9J6Q5
LinkDB All DBs
Structure
PDB: 

Position
22q11.23
AA seq 244 aa AA seqDB search
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcctagagctgtttcttgacctggtgtcccagcccagccgcgccgtctacatcttc
gccaagaagaatggcatccccttagagctgcgcaccgtggatttggtcaaagggcagcac
aagagcaaggagttcttgcagatcaacagcctggggaaactgccgacgctcaaggatggt
gatttcatcttgaccgaaagctcggccatcctgatttacctgagctgtaagtaccagacg
ccggaccactggtatccatctgacctgcaggctcgtgcccgtgttcatgagtacctgggc
tggcatgccgactgcatccgtggcacctttggtatacccctgtgggtccaggtgttgggg
ccactcattggggtccaggtgcccgaggagaaggtggaacgcaacaggactgccatggac
caggccctgcaatggctggaggacaagttcctgggggacaggcccttcctcgctggccag
caggtgacactggctgatctcatggccctggaggagctgatgcagccggtggctctcggc
tatgaactgtttgagggacggccacgactggcagcatggcgtggacgagtggaggctttc
ctgggtgctgagctatgccaggaggcccacagcatcatcttgagcatcctggaacaggcg
gccaagaaaaccctcccaacaccctcaccagaggcctatcaggctatgctgcttcgaatc
gccaggatcccctga

KEGG   Homo sapiens (human): 9446Help
Entry
9446              CDS       T01001                                 

Gene name
GSTO1, GSTO_1-1, GSTTLp28, HEL-S-21, P28, SPG-R
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    9446 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    9446 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    9446 (GSTO1)
   00983 Drug metabolism - other enzymes
    9446 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9446 (GSTO1)
   05204 Chemical carcinogenesis
    9446 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    9446 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    9446 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    9446 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    9446 (GSTO1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     9446 (GSTO1)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   9446 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 9446
NCBI-ProteinID: NP_004823
OMIM: 605482
HGNC: 13312
Ensembl: ENSG00000148834
Vega: OTTHUMG00000019001
Pharos: P78417(Tbio)
UniProt: P78417 V9HWG9
LinkDB All DBs
Structure
PDB: 

Position
10q25.1
AA seq 241 aa AA seqDB search
MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggagtcagccaggagcttggggaagggaagcgcgcccccggggccggtcccg
gagggctcgatccgcatctacagcatgaggttctgcccgtttgctgagaggacgcgtcta
gtcctgaaggccaagggaatcaggcatgaagtcatcaatatcaacctgaaaaataagcct
gagtggttctttaagaaaaatccctttggtctggtgccagttctggaaaacagtcagggt
cagctgatctacgagtctgccatcacctgtgagtacctggatgaagcatacccagggaag
aagctgttgccggatgacccctatgagaaagcttgccagaagatgatcttagagttgttt
tctaaggtgccatccttggtaggaagctttattagaagccaaaataaagaagactatgct
ggcctaaaagaagaatttcgtaaagaatttaccaagctagaggaggttctgactaataag
aagacgaccttctttggtggcaattctatctctatgattgattacctcatctggccctgg
tttgaacggctggaagcaatgaagttaaatgagtgtgtagaccacactccaaaactgaaa
ctgtggatggcagccatgaaggaagatcccacagtctcagccctgcttactagtgagaaa
gactggcaaggtttcctagagctctacttacagaacagccctgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system