KEGG   Homo sapiens (human): 1195
Entry
1195              CDS       T01001                                 

Gene name
CLK1, CLK, CLK/STY, STY
Definition
(RefSeq) CDC like kinase 1
  KO
K23561  dual specificity protein kinase CLK1/4 [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    1195 (CLK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1195 (CLK1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    1195 (CLK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     1195 (CLK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CLK family
   1195 (CLK1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    1195 (CLK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 1195
NCBI-ProteinID: NP_004062
OMIM: 601951
HGNC: 2068
Ensembl: ENSG00000013441
Vega: OTTHUMG00000132784
Pharos: P49759(Tchem)
UniProt: P49759
LinkDB
Structure
PDB: 

Position
2q33.1
AA seq 484 aa
MRHSKRTYCPDWDDKDWDYGKWRSSSSHKRRKRSHSSAQENKRCKYNHSKMCDSHYLESR
SINEKDYHSRRYIDEYRNDYTQGCEPGHRQRDHESRYQNHSSKSSGRSGRSSYKSKHRIH
HSTSHRRSHGKSHRRKRTRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVECID
HKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIV
FELLGLSTYDFIKENGFLPFRLDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQSD
YTEAYNPKIKRDERTLINPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPC
DVWSIGCILIEYYLGFTVFPTHDSKEHLAMMERILGPLPKHMIQKTRKRKYFHHDRLDWD
EHSSAGRYVSRRCKPLKEFMLSQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL
KKSI
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgagacactcaaagagaacttactgtcctgattgggatgacaaggattgggattatgga
aaatggaggagcagcagcagtcataaaagaaggaagagatcacatagcagtgcccaggag
aacaagcgctgcaaatacaatcactctaaaatgtgtgatagccattatttggaaagcagg
tctataaatgagaaagattatcatagtcgacgctacattgatgagtacagaaatgactac
actcaaggatgtgaacctggacatcgccaaagagaccatgaaagccggtatcagaaccat
agtagcaagtcttctggtagaagtggaagaagtagttataaaagcaaacacaggattcac
cacagtacttcacatcgtcgttcacatgggaagagtcaccgaaggaaaagaaccaggagt
gtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagtgcaaga
tatgaaattgttgatactttaggtgaaggagcttttggaaaagttgtggagtgcatcgat
cataaagcgggaggtagacatgtagcagtaaaaatagttaaaaatgtggatagatactgt
gaagctgctcgctcagaaatacaagttctggaacatctgaatacaacagaccccaacagt
actttccgctgtgtccagatgttggaatggtttgagcatcatggtcacatttgcattgtt
tttgaactattgggacttagtacttacgacttcattaaagaaaatggttttctaccattt
cgactggatcatatcagaaagatggcatatcagatatgcaagtctgtgaattttttgcac
agtaataagttgactcacacagacttaaagcctgaaaacatcttatttgtgcagtctgac
tacacagaggcgtataatcccaaaataaaacgtgatgaacgcaccttaataaatccagat
attaaagttgtagactttggtagtgcaacatatgatgacgaacatcacagtacattggta
tctacaagacattatagagcacctgaagttattttagccctagggtggtcccaaccatgt
gatgtctggagcataggatgcattcttattgaatactatcttgggtttaccgtatttcca
acacacgatagtaaggagcatttagcaatgatggaaaggattcttggacctctaccaaaa
catatgatacagaaaaccaggaaacgtaaatattttcaccacgatcgattagactgggat
gaacacagttctgccggcagatatgtttcaagacgctgtaaacctctgaaggaatttatg
ctttctcaagatgttgaacatgagcgtctctttgacctcattcagaaaatgttggagtat
gatccagccaaaagaattactctcagagaagccttaaagcatcctttctttgaccttctg
aagaaaagtatatag

KEGG   Homo sapiens (human): 57396
Entry
57396             CDS       T01001                                 

Gene name
CLK4
Definition
(RefSeq) CDC like kinase 4
  KO
K23561  dual specificity protein kinase CLK1/4 [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    57396 (CLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    57396 (CLK4)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    57396 (CLK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     57396 (CLK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CLK family
   57396 (CLK4)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    57396 (CLK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Spo7_2_N
Other DBs
NCBI-GeneID: 57396
NCBI-ProteinID: NP_065717
OMIM: 607969
HGNC: 13659
Ensembl: ENSG00000113240
Vega: OTTHUMG00000130893
Pharos: Q9HAZ1(Tchem)
UniProt: Q9HAZ1
LinkDB
Structure
PDB: 
6FYV

Position
5q35.3
AA seq 481 aa
MRHSKRTHCPDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEAR
SLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRH
CSSHQSRSKSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHG
MDGMHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPQHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTQRITLDEALQHPFFDLLKK
K
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgcggcattccaaaagaactcactgtcctgattgggatagcagagaaagctggggacat
gaaagctatcgtggaagtcacaagcggaagaggagatctcatagtagcacacaagagaac
aggcattgtaaaccacatcaccagtttaaagaatctgattgtcattatttagaagcaagg
tccttgaatgagcgagattatcgggaccggagatacgttgacgaatacaggaatgactac
tgtgaaggatatgttcctagacattatcacagagacattgaaagcgggtatcgaatccac
tgcagtaaatcttcagtccgcagcaggagaagcagtcctaaaaggaagcgcaatagacac
tgttcaagtcatcagtcacgttcgaagagccaccgaaggaaaagatccaggagtatagag
gatgatgaggagggtcacctgatctgtcaaagtggagacgttctaagagcaagatatgaa
atcgtggacactttgggtgaaggagcctttggcaaagttgtagagtgcattgatcatggc
atggatggcatgcatgtagcagtgaaaatcgtaaaaaatgtaggccgttaccgtgaagca
gctcgttcagaaatccaagtattagagcacttaaatagtactgatcccaatagtgtcttc
cgatgtgtccagatgctagaatggtttgatcatcatggtcatgtttgtattgtgtttgaa
ctactgggacttagtacttacgatttcattaaagaaaacagctttctgccatttcaaatt
gaccacatcaggcagatggcgtatcagatctgccagtcaataaattttttacatcataat
aaattaacccatacagatctgaagcctgaaaatattttgtttgtgaagtctgactatgta
gtcaaatataattctaaaatgaaacgtgatgaacgcacactgaaaaacacagatatcaaa
gttgttgactttggaagtgcaacgtatgatgatgaacatcacagtactttggtgtctacc
cggcactacagagctcccgaggtcattttggctttaggttggtctcagccttgtgatgtt
tggagcataggttgcattcttattgaatattaccttggtttcacagtctttcagactcat
gatagtaaagagcacctggcaatgatggaacgaatattaggacccataccacaacacatg
attcagaaaacaagaaaacgcaagtattttcaccataaccagctagattgggatgaacac
agttctgctggtagatatgttaggagacgctgcaaaccgttgaaggaatttatgctttgt
catgatgaagaacatgagaaactgtttgacctggttcgaagaatgttagaatatgatcca
actcaaagaattaccttggatgaagcattgcagcatcctttctttgacttattaaaaaag
aaatga

DBGET integrated database retrieval system