KEGG   Homo sapiens (human): 122011
Entry
122011            CDS       T01001                                 

Gene name
CSNK1A1L, CK1
Definition
(RefSeq) casein kinase 1 alpha 1 like
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    122011 (CSNK1A1L)
   04340 Hedgehog signaling pathway
    122011 (CSNK1A1L)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    122011 (CSNK1A1L)
   05226 Gastric cancer
    122011 (CSNK1A1L)
   05224 Breast cancer
    122011 (CSNK1A1L)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122011 (CSNK1A1L)
   05022 Pathways of neurodegeneration - multiple diseases
    122011 (CSNK1A1L)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    122011 (CSNK1A1L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    122011 (CSNK1A1L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     122011 (CSNK1A1L)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   122011 (CSNK1A1L)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal ABC1 APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 122011
NCBI-ProteinID: NP_660204
HGNC: 20289
Ensembl: ENSG00000180138
Vega: OTTHUMG00000016748
Pharos: Q8N752(Tdark)
UniProt: Q8N752
LinkDB
Position
13q13.3
AA seq 337 aa
MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEDVAVKLESQKVKHPQLLYE
SKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKH
LIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLRAMTKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgacaaacaacagcggctccaaagccgaactcgttgtgggagggaaatacaaactggtg
cggaagatcgggtctggctcctttggagacgtttatctgggcatcaccaccaccaacggc
gaggacgtagcagtgaagctggaatctcagaaggtcaagcacccccagttgctgtatgag
agcaaactctacacgattcttcaaggtggggttggcatcccccacatgcactggtatggt
caggaaaaagacaacaatgtgctagtcatggaccttctgggacccagcctcgaagacctc
tttaatttctgttcaagaaggttcaccatgaaaactgtacttatgttagccgaccagatg
atcagcagaattgaatacgtgcatacaaagaattttctacaccgagacattaaaccagat
aacttcctgatgggtactgggcgtcactgtaataagttgttccttattgattttggtttg
gccaaaaagtacagagacaacaggaccaggcaacacataccgtacagagaagataaacac
ctcattggcactgtccgatatgccagcatcaatgcacatcttggtattgagcagagccgc
cgagatgacatggaatccttaggctacgttttcatgtattttaatagaaccagcctgccg
tggcaaggactaagggctatgacaaaaaaacaaaaatatgaaaagattagtgagaagaag
atgtccacccctgttgaagttttatgtaaggggtttcctgcagaattcgccatgtacttg
aactactgtcgtgggctgcgctttgaggaagtcccagattacatgtatctgaggcagcta
ttccgcattcttttcaggaccctgaaccaccaatatgactacacatttgattggacgatg
ttaaagcagaaagcagcacagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccagacaggcaagcaaactgaaaaaaacaagaataatgtgaaagataactaa

KEGG   Homo sapiens (human): 1452
Entry
1452              CDS       T01001                                 

Gene name
CSNK1A1, CK1, CK1a, CKIa, HEL-S-77p, HLCDGP1, PRO2975
Definition
(RefSeq) casein kinase 1 alpha 1
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    1452 (CSNK1A1)
   04340 Hedgehog signaling pathway
    1452 (CSNK1A1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    1452 (CSNK1A1)
   05226 Gastric cancer
    1452 (CSNK1A1)
   05224 Breast cancer
    1452 (CSNK1A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1452 (CSNK1A1)
   05022 Pathways of neurodegeneration - multiple diseases
    1452 (CSNK1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1452 (CSNK1A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    1452 (CSNK1A1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1452 (CSNK1A1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   1452 (CSNK1A1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin APH ABC1 Kdo
Other DBs
NCBI-GeneID: 1452
NCBI-ProteinID: NP_001883
OMIM: 600505
HGNC: 2451
Ensembl: ENSG00000113712
Vega: OTTHUMG00000163463
Pharos: P48729(Tchem)
UniProt: P48729
LinkDB
Structure
PDB: 
6GZD 5FQD

Position
5q32
AA seq 337 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgagtagcagcggctccaaggctgaattcattgtcggagggaaatataaactggta
cggaagatcgggtctggctccttcggggacatctatttggcgatcaacatcaccaacggc
gaggaagtggcagtgaagctagaatctcagaaggccaggcatccccagttgctgtacgag
agcaagctctataagattcttcaaggtggggttggcatcccccacatacggtggtatggt
caggaaaaagactacaatgtactagtcatggatcttctgggacctagcctcgaagacctc
ttcaatttctgttcaagaaggttcacaatgaaaactgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacattaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagttattccttattgattttggtttg
gccaaaaagtacagagacaacaggacaaggcaacacataccatacagagaagataaaaac
ctcactggcactgcccgatatgctagcatcaatgcacatcttggtattgagcagagtcgc
cgagatgacatggaatcattaggatatgttttgatgtattttaatagaaccagcctgcca
tggcaagggctaaaggctgcaacaaagaaacaaaaatatgaaaagattagtgaaaagaag
atgtccacgcctgttgaagttttatgtaaggggtttcctgcagaatttgcgatgtactta
aactattgtcgtgggctacgctttgaggaagccccagattacatgtatctgaggcagcta
ttccgcattcttttcaggaccctgaaccatcaatatgactacacatttgattggacaatg
ttaaagcagaaagcagcacagcaggcagcctcttccagtgggcagggtcagcaggcccaa
acccccacaggcaagcaaactgacaaaaccaagagtaacatgaaaggtttctaa

DBGET integrated database retrieval system