KEGG   Homo sapiens (human): 122042
Entry
122042            CDS       T01001                                 

Gene name
RXFP2, GPR106, GREAT, INSL3R, LGR8, LGR8.1, RXFPR2
Definition
(RefSeq) relaxin family peptide receptor 2
  KO
K04307  relaxin family peptide receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    122042 (RXFP2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    122042 (RXFP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    122042 (RXFP2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Relaxin
    122042 (RXFP2)
SSDB
Motif
Pfam: LRR_8 7tm_1 LRR_5 LRR_4 Ldl_recept_a LRR_9 FtsK_4TM
Other DBs
NCBI-GeneID: 122042
NCBI-ProteinID: NP_570718
OMIM: 606655
HGNC: 17318
Ensembl: ENSG00000133105
Vega: OTTHUMG00000016690
Pharos: Q8WXD0(Tbio)
UniProt: Q8WXD0
LinkDB
Structure
PDB: 
2M96

Position
13q13.1
AA seq 754 aa
MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQGSMITPSCQKGYFPCGNLTKCLP
RAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKET
ELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKA
FFGLCNLQILYLNHNCITTLRPGIFKDLHQLTWLILDDNPITRISQRLFTGLNSLFFLSM
VNNYLEALPKQMCAQMPQLNWVDLEGNRIKYLTNSTFLSCDSLTVLFLPRNQIGFVPEKT
FSSLKNLGELDLSSNTITELSPHLFKDLKLLQKLNLSSNPLMYLHKNQFESLKQLQSLDL
ERIEIPNINTRMFQPMKNLSHIYFKNFRYCSYAPHVRICMPLTDGISSFEDLLANNILRI
FVWVIAFITCFGNLFVIGMRSFIKAENTTHAMSIKILCCADCLMGVYLFFVGIFDIKYRG
QYQKYALLWMESVQCRLMGFLAMLSTEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSV
ILICIWMAGFLIAVIPFWNKDYFGNFYGKNGVCFPLYYDQTEDIGSKGYSLGIFLGVNLL
AFLIIVFSYITMFCSIQKTALQTTEVRNCFGREVAVANRFFFIVFSDAICWIPVFVVKIL
SLFRVEIPDTMTSWIVIFFLPVNSALNPILYTLTTNFFKDKLKQLLHKHQRKSIFKIKKK
SLSTSIVWIEDSSSLKLGVLNKITLGDSIMKPVS
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgattgtttttctggtttttaaacatctcttcagcctcagattgattacaatgttcttt
ctacttcatttcatcgttctgatcaatgtcaaagattttgcactgactcaaggtagcatg
atcactccttcatgccaaaaaggatattttccctgtgggaatcttaccaagtgcttaccc
cgagcttttcactgtgatggcaaggatgactgtgggaacggggcggacgaagagaactgt
ggtgacactagtggatgggcgaccatatttggcacagtgcatggaaatgctaacagcgtg
gccttaacacaggagtgctttctaaaacagtatccacaatgctgtgactgcaaagaaact
gaattggaatgtgtaaatggtgacttaaagtctgtgccgatgatttctaacaatgtgaca
ttactgtctcttaagaaaaacaaaatccacagtcttccagataaagttttcatcaaatac
acaaaacttaaaaagatatttcttcagcataattgcattagacacatatccaggaaagca
ttttttggattatgtaatctgcaaatattatatctcaaccacaactgcatcacaaccctc
agacctggaatattcaaagacttacatcagctaacttggctaattctagatgacaatcca
ataaccagaatttcacagcgcttgtttacgggattaaattccttgtttttcctgtctatg
gttaataactacttagaagctcttcccaagcagatgtgtgcccaaatgcctcaactcaac
tgggtggatttggaaggcaatagaataaagtatctcacaaattctacgtttctgtcgtgc
gattcgctcacagtgctgtttctgcctagaaatcaaattggttttgttccagagaagaca
ttttcttcattaaaaaatttaggagaactggatctgtctagcaatacgataacggaacta
tcacctcacctttttaaagacttgaagcttctacaaaagctgaacctgtcatccaatcct
cttatgtatcttcacaagaaccagtttgaaagtcttaaacaacttcagtctctagacctg
gaaaggatagagattccaaatataaacacacgaatgtttcaacccatgaagaatctttct
cacatttatttcaaaaactttcgatactgctcctatgctccccatgtccgaatatgtatg
cccttgacggacggcatttcttcatttgaggacctcttggctaacaatatcctcagaata
tttgtctgggttatagctttcattacctgctttggaaatctttttgtcattggcatgaga
tctttcattaaagctgaaaatacaactcacgctatgtccatcaaaatcctttgttgtgct
gattgcctgatgggtgtttacttgttctttgttggcattttcgatataaaataccgaggg
cagtatcagaagtatgccttgctgtggatggagagcgtgcagtgccgcctcatggggttc
ctggccatgctgtccaccgaagtctctgttctgctactgacctacttgactttggagaag
ttcctggtcattgtcttccccttcagtaacattcgacctggaaaacggcagacctcagtc
atcctcatttgcatctggatggcgggatttttaatagctgtaattccattttggaataag
gattattttggaaacttttatgggaaaaatggagtatgtttcccactttattatgaccaa
acagaagatattggaagcaaagggtattctcttggaattttcctaggtgtgaacttgctg
gcttttctcatcattgtgttttcctatattactatgttctgttccattcaaaaaaccgcc
ttgcagaccacagaagtaaggaattgttttggaagagaggtggctgttgcaaatcgtttc
ttttttatagtgttctctgatgccatctgctggattcctgtatttgtagttaaaatcctt
tccctcttccgggtggaaataccagacacaatgacttcctggatagtgatttttttcctt
ccagttaacagtgctttgaatccaatcctctatactctcacaaccaacttttttaaggac
aagttgaaacagctgctgcacaaacatcagaggaaatcaattttcaaaattaaaaaaaaa
agtttatctacatccattgtgtggatagaggactcctcttccctgaaacttggggttttg
aacaaaataacacttggagacagtataatgaaaccagtttcctag

KEGG   Homo sapiens (human): 339403
Entry
339403            CDS       T01001                                 

Gene name
RXFP4, GPCR142, GPR100, RLN3R2, RXFPR4
Definition
(RefSeq) relaxin family peptide/INSL5 receptor 4
  KO
K08398  relaxin family peptide receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    339403 (RXFP4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    339403 (RXFP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    339403 (RXFP4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Relaxin
    339403 (RXFP4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 339403
NCBI-ProteinID: NP_871001
OMIM: 609043
HGNC: 14666
Ensembl: ENSG00000173080
Vega: OTTHUMG00000017463
Pharos: Q8TDU9(Tbio)
UniProt: Q8TDU9
LinkDB
Position
1q22
AA seq 374 aa
MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAV
LWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTA
TVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFG
VEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQD
SRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHS
NSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESR
PSTLLTNLDRGTPG
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgcccacactcaatacttctgcctctccacccacattcttctgggccaatgcctccgga
ggcagtgtgctgagtgctgatgatgctccgatgcctgtcaaattcctagccctgaggctc
atggttgccctggcctatgggcttgtgggggccattggcttgctgggaaatttggcggtg
ctgtgggtactgagtaactgtgcccggagagcccctggcccaccttcagacaccttcgtc
ttcaacctggctctggcggacctgggactggcactcactctccccttttgggcagccgag
tcggcactggactttcactggcccttcggaggtgccctctgcaagatggttctgacggcc
actgtcctcaacgtctatgccagcatcttcctcatcacagcgctgagcgttgctcgctac
tgggtggtggccatggctgcggggccaggcacccacctctcactcttctgggcccgaata
gccaccctggcagtgtgggcggcggctgccctggtgacggtgcccacagctgtcttcggg
gtggagggtgaggtgtgtggtgtgcgcctttgcctgctgcgtttccccagcaggtactgg
ctgggggcctaccagctgcagagggtggtgctggctttcatggtgcccttgggcgtcatc
accaccagctacctgctgctgctggccttcctgcagcggcggcaacggcggcggcaggac
agcagggtcgtggcccgctctgtccgcatcctggtggcttccttcttcctctgctggttt
cccaaccatgtggtcactctctggggtgtcctggtgaagtttgacctggtgccctggaac
agtactttctatactatccagacgtatgtcttccctgtcactacttgcttggcacacagc
aatagctgcctcaaccctgtgctgtactgtctcctgaggcgggagccccggcaggctctg
gcaggcaccttcagggatctgcggttgaggctgtggccccagggcggaggctgggtgcaa
caggtggccctaaagcaggtaggcaggcggtgggtcgcaagcaacccccgggagagccgc
ccttctaccctgctcaccaacctggacagagggacacccgggtga

KEGG   Homo sapiens (human): 51289
Entry
51289             CDS       T01001                                 

Gene name
RXFP3, GPCR135, RLN3R1, RXFPR3, SALPR
Definition
(RefSeq) relaxin family peptide receptor 3
  KO
K08397  relaxin family peptide receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    51289 (RXFP3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    51289 (RXFP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    51289 (RXFP3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Relaxin
    51289 (RXFP3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 51289
NCBI-ProteinID: NP_057652
OMIM: 609445
HGNC: 24883
Ensembl: ENSG00000182631
Vega: OTTHUMG00000090685
Pharos: Q9NSD7(Tbio)
UniProt: Q9NSD7
LinkDB
Position
5p13.2
AA seq 469 aa
MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGA
PPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLF
VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTR
YHSVASALKSHRTRGHGRGDCCGRSLGDSCCFSAKALCVWIWALAALASLPSAIFSTTVK
VMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPLGIIILCYLLLVRFIADRRAA
GTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAVPFS
QEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA
TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgcagatggccgatgcagccacgatagccaccatgaataaggcagcaggcggggacaag
ctagcagaactcttcagtctggtcccggaccttctggaggcggccaacacgagtggtaac
gcgtcgctgcagcttccggacttgtggtgggagctggggctggagttgccggacggcgcg
ccgccaggacatcccccgggcagcggcggggcagagagcgcggacacagaggcccgggtg
cggattctcatcagcgtggtgtactgggtggtgtgcgccctggggttggcgggcaacctg
ctggttctctacctgatgaagagcatgcagggctggcgcaagtcctctatcaacctcttc
gtcaccaacctggcgctgacggactttcagtttgtgctcaccctgcccttctgggcggtg
gagaacgctcttgacttcaaatggcccttcggcaaggccatgtgtaagatcgtgtccatg
gtgacgtccatgaacatgtacgccagcgtgttcttcctcactgccatgagtgtgacgcgc
taccattcggtggcctcggctctgaagagccaccggacccgaggacacggccggggcgac
tgctgcggccggagcctgggggacagctgctgcttctcggccaaggcgctgtgtgtgtgg
atctgggctttggccgcgctggcctcgctgcccagtgccattttctccaccacggtcaag
gtgatgggcgaggagctgtgcctggtgcgtttcccggacaagttgctgggccgcgacagg
cagttctggctgggcctctaccactcgcagaaggtgctgctgggcttcgtgctgccgctg
ggcatcattatcttgtgctacctgctgctggtgcgcttcatcgccgaccgccgcgcggcg
gggaccaaaggaggggccgcggtagccggaggacgcccgaccggagccagcgcccggaga
ctgtcgaaggtcaccaaatcagtgaccatcgttgtcctgtccttcttcctgtgttggctg
cccaaccaggcgctcaccacctggagcatcctcatcaagttcaacgcggtgcccttcagc
caggagtatttcctgtgccaggtatacgcgttccctgtgagcgtgtgcctagcgcactcc
aacagctgcctcaaccccgtcctctactgcctcgtgcgccgcgagttccgcaaggcgctc
aagagcctgctgtggcgcatcgcgtctccttcgatcaccagcatgcgccccttcaccgcc
actaccaagccggagcacgaggatcaggggctgcaggccccggcgccgccccacgcggcc
gcggagccggacctgctctactacccacctggcgtcgtggtctacagcggggggcgctac
gacctgctgcccagcagctctgcctactga

KEGG   Homo sapiens (human): 59350
Entry
59350             CDS       T01001                                 

Gene name
RXFP1, LGR7, RXFPR1
Definition
(RefSeq) relaxin family peptide receptor 1
  KO
K04306  relaxin family peptide receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04926  Relaxin signaling pathway
Drug target
Serelaxin: D10488
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    59350 (RXFP1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    59350 (RXFP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    59350 (RXFP1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Relaxin
    59350 (RXFP1)
SSDB
Motif
Pfam: LRR_8 7tm_1 LRR_5 LRR_4 LRR_9 Ldl_recept_a LRRNT
Other DBs
NCBI-GeneID: 59350
NCBI-ProteinID: NP_067647
OMIM: 606654
HGNC: 19718
Ensembl: ENSG00000171509
Vega: OTTHUMG00000149973
Pharos: Q9HBX9(Tbio)
UniProt: Q9HBX9
LinkDB
Structure
PDB: 
2JM4

Position
4q32.1
AA seq 757 aa
MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED
NCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRA
VPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLY
LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPDK
PLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDEL
DLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQ
RMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTC
FGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQLWM
ESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGF
IVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQIYSVAIFLGINLAAFIIIVFSYG
SMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVKFLSLLQVEIPGT
ITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWV
EMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgacatctggttctgtcttcttctacatcttaatttttggaaaatatttttctcatggg
ggtggacaggatgtcaagtgctcccttggctatttcccctgtgggaacatcacaaagtgc
ttgcctcagctcctgcactgtaacggtgtggacgactgcgggaatcaggccgatgaggac
aactgtggagacaacaatggatggtctctgcaatttgacaaatattttgccagttactac
aaaatgacttcccaatatccttttgaggcagaaacacctgaatgtttggtcggttctgtg
ccagtgcaatgtctttgccaaggtctggagcttgactgtgatgaaaccaatttacgagct
gttccatcggtttcttcaaatgtgactgcaatgtcacttcagtggaacttaataagaaag
cttcctcctgattgcttcaagaattatcatgatcttcagaagctgtacctgcaaaacaat
aagattacatccatctccatctatgctttcagaggactgaatagccttactaaactgtat
ctcagtcataacagaataaccttcctgaagccgggtgtttttgaagatcttcacagacta
gaatggctgataattgaagataatcacctcagtcgaatttccccaccaacattttatgga
ctaaattctcttattctcttagtcctgatgaataacgtcctcacccgtttacctgataaa
cctctctgtcaacacatgccaagactacattggctggaccttgaaggcaaccatatccat
aatttaagaaatttgacttttatttcctgcagtaatttaactgttttagtgatgaggaaa
aacaaaattaatcacttaaatgaaaatacttttgcacctctccagaaactggatgaattg
gatttaggaagtaataagattgaaaatcttccaccgcttatattcaaggacctgaaggag
ctgtcacaattgaatctttcctataatccaatccagaaaattcaagcaaaccaatttgat
tatcttgtcaaactcaagtctctcagcctagaagggattgaaatttcaaatatccaacaa
aggatgtttagacctcttatgaatctctctcacatatattttaagaaattccagtactgt
gggtatgcaccacatgttcgcagctgtaaaccaaacactgatggaatttcatctctagag
aatctcttggcaagcattattcagagagtatttgtctgggttgtatctgcagttacctgc
tttggaaacatttttgtcatttgcatgcgaccttatatcaggtctgagaacaagctgtat
gccatgtcaatcatttctctctgctgtgccgactgcttaatgggaatatatttattcgtg
atcggaggctttgacctaaagtttcgtggagaatacaataagcatgcgcagctgtggatg
gagagtactcattgtcagcttgtaggatctttggccattctgtccacagaagtatcagtt
ttactgttaacatttctgacattggaaaaatacatctgcattgtctatccttttagatgt
gtgagacctggaaaatgcagaacaattacagttctgattctcatttggattactggtttt
atagtggctttcattccattgagcaataaggaatttttcaaaaactactatggcaccaat
ggagtatgcttccctcttcattcagaagatacagaaagtattggagcccagatttattca
gtggcaatttttcttggtattaatttggccgcatttatcatcatagttttttcctatgga
agcatgttttatagtgttcatcaaagtgccataacagcaactgaaatacggaatcaagtt
aaaaaagagatgatccttgccaaacgttttttctttatagtatttactgatgcattatgc
tggatacccatttttgtagtgaaatttctttcactgcttcaggtagaaataccaggtacc
ataacctcttgggtagtgatttttattctgcccattaacagtgctttgaacccaattctc
tatactctgaccacaagaccatttaaagaaatgattcatcggttttggtataactacaga
caaagaaaatctatggacagcaaaggtcagaaaacatatgctccatcattcatctgggtg
gaaatgtggccactgcaggagatgccacctgagttaatgaagccggaccttttcacatac
ccctgtgaaatgtcactgatttctcaatcaacgagactcaattcctattcatga

DBGET integrated database retrieval system