KEGG   Homo sapiens (human): 122809Help
Entry
122809            CDS       T01001                                 

Gene name
SOCS4, SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    122809 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    122809 (SOCS4)
   04917 Prolactin signaling pathway
    122809 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    122809 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    122809 (SOCS4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     122809 (SOCS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOCS SOCS_box SH2
Motif
Other DBs
NCBI-GeneID: 122809
NCBI-ProteinID: NP_543143
OMIM: 616337
HGNC: 19392
Ensembl: ENSG00000180008
Vega: OTTHUMG00000140311
Pharos: Q8WXH5(Tbio)
UniProt: Q8WXH5 Q5H9R6
LinkDB All DBs
Structure
PDB: 

Position
14q22.3
AA seq 440 aa AA seqDB search
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRN
MEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaataatgaaaatattagtaaaaatgtagatgtaaggcccaaaactagtcgg
agcagaagtgccgacagaaaagacggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttattcagatgctgagacagtgaatggtatagagaaaaccgaagtg
tctttaaggaaccaagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatcgatttttaggccgatctcttaaacagaaactgcaagatgccgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccgtctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcagctaaaacgaagaaat
atggaagaaaatataaactgtttctcacataccaatgttcagccctgtgtcataaccacc
gacaatgctttgtgtagagaaggtcctatgactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattccgatgatgaaattctaacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggatttggatgatgaaatcctgcagttggaaaca
cctcctaaataccacacgcagattgattatgtccactgtcttgtaccagacctccttcag
atcaataacaacccatgttactggggagtgatggataaatacgcagccgaagcactactg
gaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagactatttattc
tctgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacatgacccctgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagcgcctgtatgttctttgaaccacttctatccactccc
ttaattcggactttccctttttccctgcagcatatatgcagaacagttatttgtaactgt
acaacttatgatggcatcgatgcccttccaattccttcttctatgaaattatatctgaag
gaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacagcaatgc
tag

DBGET integrated database retrieval system