KEGG   Homo sapiens (human): 122809Help
Entry
122809            CDS       T01001                                 

Gene name
SOCS4, SOCS7
Definition
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    122809 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    122809 (SOCS4)
   04917 Prolactin signaling pathway
    122809 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    122809 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    122809 (SOCS4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     122809 (SOCS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOCS SOCS_box SH2
Motif
Other DBs
NCBI-GeneID: 122809
NCBI-ProteinID: NP_543143
OMIM: 616337
HGNC: 19392
Ensembl: ENSG00000180008
Vega: OTTHUMG00000140311
Pharos: Q8WXH5(Tbio)
UniProt: Q8WXH5 Q5H9R6
LinkDB All DBs
Structure
PDB: 

Position
14q22.3
AA seq 440 aa AA seqDB search
MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEV
SLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTAPINSKSDEWVSTDLSQTELRDGQLKRRN
MEENINCFSHTNVQPCVITTDNALCREGPMTGSVMNLVSNNSIEDSDMDSDDEILTLCTS
SRKRNKPKWDLDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALL
EGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGL
LEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLK
EYHYKSKVRVLRIDAPEQQC
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaataatgaaaatattagtaaaaatgtagatgtaaggcccaaaactagtcgg
agcagaagtgccgacagaaaagacggttatgtgtggagtggaaagaagttatcttggtca
aaaaagagtgagagttattcagatgctgagacagtgaatggtatagagaaaaccgaagtg
tctttaaggaaccaagaaaggaagcacagctgttcatccattgagttggacttagatcat
tcctgtgggcatcgatttttaggccgatctcttaaacagaaactgcaagatgccgtgggg
cagtgttttccaataaagaattgtagtagtcggcactcttcagggcttccgtctaaaagg
aaaattcatatcagtgaactcatgttagataagtgtcctttcccacctcgatcagattta
gcctttaggtggcattttattaaacgacacactgctcctataaattccaaatcagatgaa
tgggtaagcacagacttgtctcagactgaattgagggatggtcagctaaaacgaagaaat
atggaagaaaatataaactgtttctcacataccaatgttcagccctgtgtcataaccacc
gacaatgctttgtgtagagaaggtcctatgactggctctgtgatgaacctggtttcaaat
aacagtatagaagatagtgatatggattccgatgatgaaattctaacactttgcacaagt
tccagaaaaagaaacaaacccaaatgggatttggatgatgaaatcctgcagttggaaaca
cctcctaaataccacacgcagattgattatgtccactgtcttgtaccagacctccttcag
atcaataacaacccatgttactggggagtgatggataaatacgcagccgaagcactactg
gaaggaaaaccagagggtacctttttacttcgagactcagcacaggaagactatttattc
tctgttagttttagacgctatagtcgttctcttcatgctagaattgaacagtggaatcac
aactttagctttgatgcacatgacccctgtgtcttccattctcctgacattactgggctc
ctagaacattataaggacccaagcgcctgtatgttctttgaaccacttctatccactccc
ttaattcggactttccctttttccctgcagcatatatgcagaacagttatttgtaactgt
acaacttatgatggcatcgatgcccttccaattccttcttctatgaaattatatctgaag
gaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacagcaatgc
tag

KEGG   Homo sapiens (human): 30837Help
Entry
30837             CDS       T01001                                 

Gene name
SOCS7, NAP4, NCKAP4
Definition
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    30837 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    30837 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    30837 (SOCS7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     30837 (SOCS7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOCS_box SH2
Motif
Other DBs
NCBI-GeneID: 30837
NCBI-ProteinID: NP_055413
OMIM: 608788
HGNC: 29846
Ensembl: ENSG00000274211
Vega: OTTHUMG00000188546
Pharos: O14512(Tbio)
UniProt: O14512
LinkDB All DBs
Position
17q12
AA seq 645 aa AA seqDB search
MQEAELRDGEAAAAAASYRVLSRLLGYGEAAPEPGPPPPPPGHGPPPPPFLARPGPRGSR
PPQLMVFRNVGRPPEEEDVEAAPEPGPSELLCPRHRCALDPKALPPGLALERTWGPAAGL
EAQLAALGLGQPAGPGVKTVGGGCCPCPCPPQPPPPQPQPPAAAPQAGEDPTETSDALLV
LEGLESEAESLETNSCSEEELSSPGRGGGGGGRLLLQPPGPELPPVPFPLQDLVPLGRLS
RGEQQQQQQQQPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCNGGSGGGDGTGKR
PSGELAASAASLTDMGGSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDIS
QRGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHAPDAF
PRIAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKG
KPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIK
RAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIP
DLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggccgagctccgggatggcgaggcggcggcggcggccgcttcgtaccgcgtc
ctgagccgcctccttggctatggagaggcggcccccgagccaggccctccgccaccgccc
ccgggccatggccccccgccgccacccttcctcgcgcggcccggcccgcggggctcccgg
ccgccgcagctgatggtgttccgcaacgtgggtcggccgccggaggaggaggacgtggag
gcggccccggagccgggaccctcggaactgctgtgtccccggcaccgctgtgccctggac
cccaaggccctgccgccgggcttggcgctcgagcggacctggggcccggcggctggacta
gaggcgcagttggcggctctggggctcgggcagccggcggggccgggggtcaagacagtc
ggtgggggttgctgcccgtgtccgtgtcctcctcagccgccccctccgcagccccagccg
cctgctgccgccccgcaggccggggaggaccccacggaaacgagcgacgcgctgctggtc
ctggagggcttggaatcggaggccgagagcctggagactaacagctgctcggaagaggag
ctcagcagcccgggtcgcggaggaggagggggcggccggcttctgctgcagcccccaggc
cctgaattacctccggtgcccttcccgctgcaggacttggtccctctggggcgcctgagt
agaggggagcagcagcagcagcagcagcagcaacctcccccgcccccgcctcctcccggg
cccctccggccactcgcgggtccttctcggaagggctccttcaaaatccgcctcagtcgc
ctctttcgcaccaagagctgcaacggtggctccggcggtggggatgggaccggcaagagg
ccttctggagagctggctgcttcagctgcgagcctgacagacatgggaggctctgcgggc
cgggagctggacgcggggaggaaacccaagttgacaagaactcaaagtgccttttctccg
gtctccttcagccccctgttcacaggtgaaactgtgtcgcttgtggatgtggacatttct
cagcggggcctgacctctccacaccctccaactccccctcctcctccgagaagaagcctc
agcctcctagatgatatcagtgggacgctgcctacatctgtccttgtggctccgatgggg
tcttccttgcagtctttccccctacctccgcctcctccaccccatgccccagatgcattt
ccccggattgctcccatccgagcagctgaatccctgcacagccaacccccacagcacctc
cagtgtcccctctaccggcctgactcgagcagctttgcagccagccttcgagagttggag
aagtgtggttggtattgggggccaatgaattgggaagatgcagagatgaagctgaaaggg
aaaccagatggttctttcctggtacgagacagttctgatcctcgttacatcctgagcctc
agtttccgatcacagggtatcacccaccacactagaatggagcactacagaggaaccttc
agcctgtggtgtcatcccaagtttgaggaccgctgtcaatctgttgtagagtttattaag
agagccattatgcactccaagaatggaaagtttctctatttcttaagatccagggttcca
ggactgccaccaactcctgtccagctgctctatccagtgtcccgattcagcaatgtcaaa
tccctccagcacctttgcagattccggatacgacagctcgtcaggatagatcacatccca
gatctcccactgcctaaacctctgatctcttatatccgaaagttctactactatgatcct
caggaagaggtatacctgtctctaaaggaagcgcagctcatttccaaacagaagcaagag
gtggaaccctccacgtag

KEGG   Homo sapiens (human): 8651Help
Entry
8651              CDS       T01001                                 

Gene name
SOCS1, CIS1, CISH1, JAB, SOCS-1, SSI-1, SSI1, TIP-3, TIP3
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04380  Osteoclast differentiation
hsa04630  Jak-STAT signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04930  Type II diabetes mellitus
hsa05145  Toxoplasmosis
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8651 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    8651 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8651 (SOCS1)
   04917 Prolactin signaling pathway
    8651 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    8651 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    8651 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    8651 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    8651 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8651 (SOCS1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     8651 (SOCS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 8651
NCBI-ProteinID: NP_003736
OMIM: 603597
HGNC: 19383
Ensembl: ENSG00000185338
Vega: OTTHUMG00000129792
Pharos: O15524(Tbio)
UniProt: O15524 Q4JHT5
LinkDB All DBs
Position
16p13.13
AA seq 211 aa AA seqDB search
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRS
HADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMA
SGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQ
RIVATVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggtagcacacaaccaggtggcagccgacaatgcagtctccacagcagcagagccccga
cggcggccagaaccttcctcctcttcctcctcctcgcccgcggcccccgcgcgcccgcgg
ccgtgccccgcggtcccggccccggcccccggcgacacgcacttccgcacattccgttcg
cacgccgattaccggcgcatcacgcgcgccagcgcgctcctggacgcctgcggattctac
tgggggcccctgagcgtgcacggggcgcacgagcggctgcgcgccgagcccgtgggcacc
ttcctggtgcgcgacagccgccagcggaactgctttttcgcccttagcgtgaagatggcc
tcgggacccacgagcatccgcgtgcactttcaggccggccgctttcacctggatggcagc
cgcgagagcttcgactgcctcttcgagctgctggagcactacgtggcggcgccgcgccgc
atgctgggggccccgctgcgccagcgccgcgtgcggccgctgcaggagctgtgccgccag
cgcatcgtggccaccgtgggccgcgagaacctggctcgcatccccctcaaccccgtcctc
cgcgactacctgagctccttccccttccagatttga

KEGG   Homo sapiens (human): 8835Help
Entry
8835              CDS       T01001                                 

Gene name
SOCS2, CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2
Definition
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    8835 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    8835 (SOCS2)
   04917 Prolactin signaling pathway
    8835 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    8835 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8835 (SOCS2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     8835 (SOCS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Motif
Other DBs
NCBI-GeneID: 8835
NCBI-ProteinID: NP_001257396
OMIM: 605117
HGNC: 19382
Ensembl: ENSG00000120833
Vega: OTTHUMG00000170160
Pharos: O14508(Tbio)
UniProt: O14508 A0A024RBD2
LinkDB All DBs
Structure
PDB: 

Position
12q22
AA seq 198 aa AA seqDB search
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcggtgccttgagccctccgggaatggcggggaagggacgcggagccagtgg
gggaccgcggggtcggcggaggagccatccccgcaggcggcgcgtctggcgaaggccctg
cgggagctcggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgaatcgaataccaa
gacggaaaattcagattggactctatcatatgtgtcaaatccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagccccccggaacggcactgttcacctttatctgaccaaaccgctctacacgtcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtaccggtgccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Homo sapiens (human): 9021Help
Entry
9021              CDS       T01001                                 

Gene name
SOCS3, ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3
Definition
(RefSeq) suppressor of cytokine signaling 3
  KO
K04696  suppressor of cytokine signaling 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04380  Osteoclast differentiation
hsa04630  Jak-STAT signaling pathway
hsa04668  TNF signaling pathway
hsa04910  Insulin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Network
nt06122  IFN signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00576  HSV UL41/UL13 to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    9021 (SOCS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    9021 (SOCS3)
   04668 TNF signaling pathway
    9021 (SOCS3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    9021 (SOCS3)
   04920 Adipocytokine signaling pathway
    9021 (SOCS3)
   04917 Prolactin signaling pathway
    9021 (SOCS3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    9021 (SOCS3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    9021 (SOCS3)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9021 (SOCS3)
   04931 Insulin resistance
    9021 (SOCS3)
  09172 Infectious disease: viral
   05164 Influenza A
    9021 (SOCS3)
   05160 Hepatitis C
    9021 (SOCS3)
   05168 Herpes simplex virus 1 infection
    9021 (SOCS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9021 (SOCS3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     9021 (SOCS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 9021
NCBI-ProteinID: NP_003946
OMIM: 604176
HGNC: 19391
Ensembl: ENSG00000184557
Vega: OTTHUMG00000177513
Pharos: O14543(Tbio)
UniProt: O14543 Q6FI39
LinkDB All DBs
Position
17q25.3
AA seq 225 aa AA seqDB search
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccacagcaagtttcccgccgccgggatgagccgccccctggacaccagcctg
cgcctcaagaccttcagctccaagagcgagtaccagctggtggtgaacgcagtgcgcaag
ctgcaggagagcggcttctactggagcgcagtgaccggcggcgaggcgaacctgctgctc
agtgccgagcccgccggcacctttctgatccgcgacagctcggaccagcgccacttcttc
acgctcagcgtcaagacccagtctgggaccaagaacctgcgcatccagtgtgaggggggc
agcttctctctgcagagcgatccccggagcacgcagcccgtgccccgcttcgactgcgtg
ctcaagctggtgcaccactacatgccgccccctggagccccctccttcccctcgccacct
actgaaccctcctccgaggtgcccgagcagccgtctgcccagccactccctgggagtccc
cccagaagagcctattacatctactccgggggcgagaagatccccctggtgttgagccgg
cccctctcctccaacgtggccactcttcagcatctctgtcggaagaccgtcaacggccac
ctggactcctatgagaaagtcacccagctgccggggcccattcgggagttcctggaccag
tacgatgccccgctttaa

KEGG   Homo sapiens (human): 9306Help
Entry
9306              CDS       T01001                                 

Gene name
SOCS6, CIS-4, CIS4, HSPC060, SOCS-4, SOCS-6, SOCS4, SSI4, STAI4, STATI4
Definition
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    9306 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    9306 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9306 (SOCS6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     9306 (SOCS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 SOCS_box
Motif
Other DBs
NCBI-GeneID: 9306
NCBI-ProteinID: NP_004223
OMIM: 605118
HGNC: 16833
Ensembl: ENSG00000170677
Vega: OTTHUMG00000132816
Pharos: O14544(Tbio)
UniProt: O14544 A0A024R379
LinkDB All DBs
Structure
PDB: 

Position
18q22.2
AA seq 535 aa AA seqDB search
MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGED
EKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQS
ETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattagtcttaaaaccttacggaaatcttttaacttgaataaaagtaaagaa
gaaactgatttcatggtagtacaacaaccatcgctagccagtgactttggaaaagatgat
tccttatttggtagctgctatggtaaagatatggccagctgcgatatcaacggtgaagat
gaaaaaggcggaaaaaacagatcaaaaagcgagagcctgatgggtacgctaaaaaggcgg
ctttctgcaaaacagaagtcaaaaggcaaggcgggcacaccctctgggagctctgccgac
gaggacaccttctcctcctcctcagcacccatagtctttaaagacgtgagagctcagagg
ccgataaggtccacgtcgctccgcagccatcactacagtcccgcgccgtggcctctgcgg
cccacaaactccgaggagacctgcatcaagatggaggtgagagtcaaggccttggttcac
tcttccagcccgagtccagccctgaatggcgtccggaaggatttccacgacctccagtct
gagaccacgtgccaggagcaagccaattcactgaagagctcggcttctcataatggagac
ctgcatcttcacctggatgaacatgtgcctgtcgttattggacttatgcctcaggactac
attcagtatactgtgcctttagatgaggggatgtatcctttggaaggatcacggagctat
tgtctggacagctcttctcccatggaagtctctgcggttcctcctcaagtgggagggcgc
gctttccccgaggatgagagtcaggtagaccaggacctagttgtcgccccagagatcttc
gtggatcagtccgtgaatggcttgttgattggcaccacgggagtcatgttgcagagcccg
agagcgggtcacgatgatgtccctccactctcaccattgctacctccaatgcagaataat
caaatccaaaggaacttcagtggactcactggcacagaagcccacgtggctgaaagtatg
cgctgtcatttgaattttgatccgaactctgctcctggggttgcaagagtttatgactca
gtgcaaagtagtggtcccatggttgtgacaagccttacagaggagctgaaaaaacttgca
aagcaaggatggtactggggaccaatcacacgttgggaggcagaagggaagctagcaaac
gtgccagatggttcttttcttgttcgggacagttctgacgaccgttaccttttaagcttg
agctttcgctcccatggtaaaacacttcacactagaattgagcactcaaatggtaggttt
agcttttatgaacagccagatgtggaaggacatacgtccatagttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcaaggtctcggctgcctggatct
gcaacttaccccgtcagactgaccaacccagtgtcccggttcatgcaggtgcgctcgttg
cagtacctgtgtcgttttgttatacgtcagtataccagaatagacttaattcagaaactg
cctttgccaaacaaaatgaaggattatttacaggagaagcactactga

KEGG   Homo sapiens (human): 9655Help
Entry
9655              CDS       T01001                                 

Gene name
SOCS5, CIS6, CISH6, Cish5, SOCS-5
Definition
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04630  Jak-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    9655 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    9655 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9655 (SOCS5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     9655 (SOCS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOCS SOCS_box SH2 BRCT_assoc
Motif
Other DBs
NCBI-GeneID: 9655
NCBI-ProteinID: NP_054730
OMIM: 607094
HGNC: 16852
Ensembl: ENSG00000171150
Vega: OTTHUMG00000128852
Pharos: O75159(Tbio)
UniProt: O75159
LinkDB All DBs
Position
2p21
AA seq 536 aa AA seqDB search
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtgggaaaaatgtggaataacttcaaatacaggtgtcagaatctcttcggt
catgagggaggaagccgtagtgaaaatgtggacatgaactccaacagatgtttgtctgtc
aaagagaaaaacatcagcataggagactcaactcctcagcaacaaagcagtcccttaaga
gaaaatattgccttacaactgggattaagcccttcgaagaattcttcaaggagaaatcaa
aattgtgccacagaaatccctcaaattgttgaaataagcatcgaaaaggataatgattct
tgtgttaccccaggaacaagacttgcacgaagagattcctactctcgacatgctccatgg
ggtgggaagaaaaaacattcctgttctacaaagacccagagttcattggatgctgataaa
aagtttggtagaactcgaagtggacttcaaaggagagagaggcgctacggcgtaagttct
gtacacgacatggacagtgtttccagcagaactgtaggaagtcgctctctaagacagagg
ttgcaggatactgtgggcttgtgttttcccatgagaacttacagcaagcagtcaaagcct
ctcttttccaataaaagaaaaatccatctctctgaattaatgcttgagaaatgccctttt
cctgctggctcagatttagcccaaaaatggcatttgattaaacagcatacagctcctgtg
agcccacattcaacattttttgatacatttgatccatctttggtttctacagaagatgaa
gaagataggcttagagagagaaggcggcttagtattgaagaaggggttgatccccctccc
aatgcacaaatacatacatttgaagctactgcacaggttaatccattatataaactggga
ccaaaattagctcctggaatgactgaaataagtggggacagttctgcaattccacaagct
aattgtgactcggaagaggatacaaccaccctgtgtttgcagtcacggaggcagaagcag
cgtcagatatctggagacagccatacccatgttagcagacagggagcttggaaagtccac
acacagattgattacatacactgcctcgtgcctgatttgcttcaaattacagggaatccc
tgttactggggagtgatggaccgttatgaagcagaagcccttctcgaagggaaacctgaa
ggcacgtttttgctcagggactctgcgcaagaggactacctcttctctgtgagcttccgc
cgctacaacagatccctgcatgcccgaattgagcagtggaatcacaactttagtttcgac
gcccatgacccgtgtgtatttcactcctccactgtaacgggacttttagaacattataaa
gatcccagttcgtgcatgttttttgaaccattgcttactatatcactaaataggactttc
ccttttagcctgcagtatatctgtcgcgcggtaatctgcaggtgcactacgtatgatgga
attgatgggctccctctaccctcaatgttacaggattttttaaaagagtatcattataaa
caaaaagttagagttcgctggttggaacgagaaccagtcaaggcaaagtaa

DBGET integrated database retrieval system