KEGG   Homo sapiens (human): 123
Entry
123               CDS       T01001                                 

Gene name
PLIN2, ADFP, ADRP
Definition
(RefSeq) perilipin 2
  KO
K17284  perilipin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    123 (PLIN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    123 (PLIN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   123 (PLIN2)
SSDB
Motif
Pfam: Perilipin SH3BP5
Other DBs
NCBI-GeneID: 123
NCBI-ProteinID: NP_001113
OMIM: 103195
HGNC: 248
Ensembl: ENSG00000147872
Vega: OTTHUMG00000019624
Pharos: Q99541(Tbio)
UniProt: Q99541 Q6FHZ7
LinkDB
Position
9p22.1
AA seq 437 aa
MASVAVDPQPSVVTRVVNLPLVSSTYDLMSSAYLSTKDQYPYLKSVCEMAENGVKTITSV
AMTSALPIIQKLEPQIAVANTYACKGLDRIEERLPILNQPSTQIVANAKGAVTGAKDAVT
TTVTGAKDSVASTITGVMDKTKGAVTGSVEKTKSVVSGSINTVLGSRMMQLVSSGVENAL
TKSELLVEQYLPLTEEELEKEAKKVEGFDLVQKPSYYVRLGSLSTKLHSRAYQQALSRVK
EAKQKSQQTISQLHSTVHLIEFARKNVYSANQKIQDAQDKLYLSWVEWKRSIGYDDTDES
HCAEHIESRTLAIARNLTQQLQTTCHTLLSNIQGVPQNIQDQAKHMGVMAGDIYSVFRNA
ASFKEVSDSLLTSSKGQLQKMKESLDDVMDYLVNNTPLNWLVGPFYPQLTESQNAQDQGA
EMDKSSQETQRSEHKTH
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcatccgttgcagttgatccacaaccgagtgtggtgactcgggtggtcaacctgccc
ttggtgagctccacgtatgacctcatgtcctcagcctatctcagtacaaaggaccagtat
ccctacctgaagtctgtgtgtgagatggcagagaacggtgtgaagaccatcacctccgtg
gccatgaccagtgctctgcccatcatccagaagctagagccgcaaattgcagttgccaat
acctatgcctgtaaggggctagacaggattgaggagagactgcctattctgaatcagcca
tcaactcagattgttgccaatgccaaaggcgctgtgactggggcaaaagatgctgtgacg
actactgtgactggggccaaggattctgtggccagcacgatcacaggggtgatggacaag
accaaaggggcagtgactggcagtgtggagaagaccaagtctgtggtcagtggcagcatt
aacacagtcttggggagtcggatgatgcagctcgtgagcagtggcgtagaaaatgcactc
accaaatcagagctgttggtagaacagtacctccctctcactgaggaagaactagaaaaa
gaagcaaaaaaagttgaaggatttgatctggttcagaagccaagttattatgttagactg
ggatccctgtctaccaagcttcactcccgtgcctaccagcaggctctcagcagggttaaa
gaagctaagcaaaaaagccaacagaccatttctcagctccattctactgttcacctgatt
gaatttgccaggaagaatgtgtatagtgccaatcagaaaattcaggatgctcaggataag
ctctacctctcatgggtagagtggaaaaggagcattggatatgatgatactgatgagtcc
cactgtgctgagcacattgagtcacgtactcttgcaattgcccgcaacctgactcagcag
ctccagaccacgtgccacaccctcctgtccaacatccaaggtgtaccacagaacatccaa
gatcaagccaagcacatgggggtgatggcaggcgacatctactcagtgttccgcaatgct
gcctcctttaaagaagtgtctgacagcctcctcacttctagcaaggggcagctgcagaaa
atgaaggaatctttagatgacgtgatggattatcttgttaacaacacgcccctcaactgg
ctggtaggtcccttttatcctcagctgactgagtctcagaatgctcaggaccaaggtgca
gagatggacaagagcagccaggagacccagcgatctgagcataaaactcattaa

KEGG   Homo sapiens (human): 440503
Entry
440503            CDS       T01001                                 

Gene name
PLIN5, LSDA5, LSDP5, MLDP, OXPAT
Definition
(RefSeq) perilipin 5
  KO
K20255  perilipin-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    440503 (PLIN5)
SSDB
Motif
Pfam: Perilipin Fzo_mitofusin DASH_Dad2
Other DBs
NCBI-GeneID: 440503
NCBI-ProteinID: NP_001013728
OMIM: 613248
HGNC: 33196
Ensembl: ENSG00000214456
Vega: OTTHUMG00000182008
Pharos: Q00G26(Tbio)
UniProt: Q00G26
LinkDB
Position
19p13.3
AA seq 463 aa
MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLA
ENCVCGLTTRALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKD
VVASSVTGVVDLARRGRRWSVELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEA
EGPEVGSVEDQRRQQGYFVRLGSLSARIRHLAYEHSVGKLRQSKHRAQDTLAQLQETLEL
IDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAELETLVLSRSLTQELQGTVEA
LESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDE
LLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWE
AEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtctgaagaagaggcggctcagatccccagatccagtgtgtgggagcaggaccagcag
aacgtggtgcagcgtgtggtggctctgcccctggtcagggccacgtgcaccgcggtctgc
gatgtttacagtgcagccaaggacaggcacccgctgctgggctccgcctgccgcctggct
gagaactgcgtgtgcggcctgaccacccgtgccctggaccacgcccagccgctgctcgag
cacctgcagccccagctggccactatgaacagcctcgcctgcaggggcctggacaagctg
gaagagaagcttccctttctccagcaaccttcggagacggtggtgacctcagccaaggac
gtggtggccagcagtgtcacgggtgtggtggacctggcccggaggggccggcgctggagc
gtggagctgaagcgctccgtgagccatgctgtggatgttgtactggaaaaatcagaggag
ctggtggatcacttcctgcccatgacggaggaagagctcgcggcactggcggctgaggct
gaaggccctgaagtgggttcggtggaggatcagaggagacagcagggctactttgtgcgc
ctcggctccctgtcagcacggatccgccacctggcctacgagcactctgtggggaaactg
aggcagagcaaacaccgtgcccaggacaccctggcccagctgcaggagacgctggagctg
atagaccacatgcagtgtggggtgacccccaccgccccggcctgccctgggaaggtgcac
gagctgtggggggaatggggccagcgccctccggagagccgccgccggagccaggcagag
ctggagacgctggtgctgtcccgcagcctgacccaggagctgcagggcacggtagaggct
ctggagtccagcgtgcggggcctgcccgccggcgcccaggagaaggtggctgaggtgcgg
cgcagtgtggatgccctgcagaccgccttcgctgatgcccgctgcttcagggacgtgcca
gcggccgcgctggccgagggccggggtcgcgtggcccacgcgcacgcctgcgtggacgag
ctgctggagctggtggtgcaggccgtgccgctgccctggctggtgggacccttcgcgccc
atccttgtggagcgacccgagcccctgcccgacctggcggacctggtggacgaggtcatc
gggggccctgacccccgctgggcgcacctggactggccggcccagcagagagcctgggag
gcagagcacagggacgggagtgggaatggggatggggacaggatgggtgttgccggggac
atctgcgagcaggaacccgagacccccagctgcccggtcaagcacaccctgatgcccgag
ctggacttctga

KEGG   Homo sapiens (human): 5346
Entry
5346              CDS       T01001                                 

Gene name
PLIN1, FPLD4, PERI, PLIN
Definition
(RefSeq) perilipin 1
  KO
K08768  perilipin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04371  Apelin signaling pathway
hsa04714  Thermogenesis
hsa04923  Regulation of lipolysis in adipocytes
Disease
H00420  Familial partial lipodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5346 (PLIN1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    5346 (PLIN1)
   03320 PPAR signaling pathway
    5346 (PLIN1)
  09159 Environmental adaptation
   04714 Thermogenesis
    5346 (PLIN1)
SSDB
Motif
Pfam: Perilipin TfoX_C
Other DBs
NCBI-GeneID: 5346
NCBI-ProteinID: NP_001138783
OMIM: 170290
HGNC: 9076
Ensembl: ENSG00000166819
Vega: OTTHUMG00000149813
Pharos: O60240(Tbio)
UniProt: O60240
LinkDB
Position
15q26.1
AA seq 522 aa
MAVNKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEK
GVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTI
STRLRSARNSISVPIASTSDKVLGAALAGCELAWGVARDTAEFAANTRAGRLASGGADLA
LGSIEKVVEYLLPPDKEESAPAPGHQQAQKSPKAKPSLLSRVGALTNTLSRYTVQTMARA
LEQGHTVAMWIPGVVPLSSLAQWGASVAMQAVSRRRSEVRVPWLHSLAAAQEEDHEDQTD
TEGEDTEEEEELETEENKFSEVAALPGPRGLLGGVAHTLQKTLQTTISAVTWAPAAVLGM
AGRVLHLTPAPAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDID
NPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPGLEDEVATPAAP
RPGFPAVPREKPKRRVSDSFFRPSVMEPILGRTHYSQLRKKS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggcagtcaacaaaggcctcaccttgctggatggagacctccctgagcaggagaatgtg
ctgcagcgggtcctgcagctgccggtggtgagtggcacctgcgaatgcttccagaagacc
tacaccagcactaaggaagcccaccccctggtggcctctgtgtgcaatgcctatgagaag
ggcgtgcagagcgccagtagcttggctgcctggagcatggagccggtggtccgcaggctg
tccacccagttcacagctgccaatgagctggcctgccgaggcttggaccacctggaggaa
aagatccccgccctccagtacccccctgaaaagattgcttctgagctgaaggacaccatc
tccacccgcctccgcagtgccagaaacagcatcagcgttcccatcgcgagcacttcagac
aaggtcctgggggccgctttggccgggtgcgagcttgcctggggggtggccagagacact
gcggaatttgctgccaacactcgagctggccgactggcttctggaggggccgacttggcc
ttgggcagcattgagaaggtggtggagtacctcctccctccagacaaggaagagtcagcc
cctgctcctggacaccagcaagcccagaagtctcccaaggccaagccaagcctcttgagc
agggttggggctctgaccaacaccctctctcgatacaccgtgcagaccatggcccgggcc
ctggagcagggccacaccgtggccatgtggatcccaggcgtggtgcccctgagcagcctg
gcccagtggggtgcctcagtggccatgcaggcggtgtcccggcggaggagcgaagtgcgg
gtaccctggctgcacagcctcgcagccgcccaggaggaggatcatgaggaccagacagac
acggagggagaggacacggaggaggaggaagaattggagactgaggagaacaagttcagt
gaggtagcagccctgccaggccctcgaggcctcctgggtggtgtggcacataccctgcag
aagaccctccagaccaccatctcggctgtgacatgggcacctgcagctgtgctgggcatg
gcagggagggtgctgcacctcacaccagcccctgctgtctcctcaaccaaggggagggcc
atgtccctatcagatgccctgaagggcgttactgacaacgtggtggacacagtggtgcat
tacgtgccgctccccaggctgtcgctgatggagcccgagagcgaattccgggacatcgac
aacccaccagccgaggtcgagcgccgggaggcggagcgcagagcgtctggggcgccgtcc
gccggcccggagcccgccccgcgtctcgcacagccccgccgcagcctgcgcagcgcgcag
agccccggcgcgccccccggcccgggcctggaggacgaagtcgccacgcccgcagcgccg
cgcccgggcttcccggccgtgccccgcgagaagccaaagcgcagggtcagcgacagcttc
ttccggcccagcgtcatggagcccatcctgggccgcacgcattacagccagctgcgcaag
aagagctga

KEGG   Homo sapiens (human): 729359
Entry
729359            CDS       T01001                                 

Gene name
PLIN4, KIAA1881, S3-12
Definition
(RefSeq) perilipin 4
  KO
K20254  perilipin-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    729359 (PLIN4)
SSDB
Motif
Pfam: Perilipin ACP_syn_III DEC-1_N
Other DBs
NCBI-GeneID: 729359
NCBI-ProteinID: NP_001354797
OMIM: 613247
HGNC: 29393
Ensembl: ENSG00000167676
Vega: OTTHUMG00000167571
Pharos: Q96Q06(Tbio)
LinkDB
Position
19p13.3
AA seq 1371 aa
MSAPDEGRRDPPKPKGKTLGSFFGSLPGFSSARNLVANAHSSARARPAADPTGAPAAEAA
QPQAQVAAHPEQTAPWTEKELQPSEKMVSGAKDLVCSKMSRAKDAVSSGVASVVDVAKGV
VQGGLDTTRSALTGTKEVVSSGVTGAMDMAKGAVQGGLDTSKAVLTGTKDTVSTGLTGAV
NVAKGTVQAGVDTTKTVLTGTKDTVTTGVMGAVNLAKGTVQTGVETSKAVLTGTKDAVST
GLTGAVNVARGSIQTGVDTSKTVLTGTKDTVCSGVTGAMNVAKGTIQTGVDTSKTVLTGT
KDTVCSGVTGAMNVAKGTIQTGVDTSKTVLTGTKDTVCSGVTGAMNVAKGTIQTGVDTTK
TVLTGTKNTVCSGVTGAVNLAKEAIQGGLDTTKSMVMGTKDTMSTGLTGAANVAKGAMQT
GLNTTQNIATGTKDTVCSGVTGAMNLARGTIQTGVDTTKIVLTGTKDTVCSGVTGAANVA
KGAVQGGLDTTKSVLTGTKDAVSTGLTGAVNVAKGTVQTGVDTTKTVLTGTKDTVCSGVT
SAVNVAKGAVQGGLDTTKSVVIGTKDTMSTGLTGAANVAKGAVQTGVDTAKTVLTGTKDT
VTTGLVGAVNVAKGTVQTGMDTTKTVLTGTKDTIYSGVTSAVNVAKGAVQTGLKTTQNIA
TGTKNTFGSGVTSAVNVAKGAAQTGVDTAKTVLTGTKDTVTTGLMGAVNVAKGTVQTSVD
TTKTVLTGTKDTVCSGVTGAANVAKGAIQGGLDTTKSVLTGTKDAVSTGLTGAVKLAKGT
VQTGMDTTKTVLTGTKDAVCSGVTGAANVAKGAVQMGVDTAKTVLTGTKDTVCSGVTGAA
NVAKGAVQTGLKTTQNIATGTKNTLGSGVTGAAKVAKGAVQGGLDTTKSVLTGTKDAVST
GLTGAVNLAKGTVQTGVDTSKTVLTGTKDTVCSGVTGAVNVAKGTVQTGVDTAKTVLSGA
KDAVTTGVTGAVNVAKGTVQTGVDASKAVLMGTKDTVFSGVTGAMSMAKGAVQGGLDTTK
TVLTGTKDAVSAGLMGSGNVATGATHTGLSTFQNWLPSTPATSWGGLTSSRTTDNGGEQT
ALSPQEAPFSGISTPPDVLSVGPEPAWEAAATTKGLATDVATFTQGAAPGREDTGLLATT
HGPEEAPRLAMLQNELEGLGDIFHPMNAEEQAQLAASQPGPKVLSAEQGSYFVRLGDLGP
SFRQRAFEHAVSHLQHGQFQARDTLAQLQDCFRLIEKAQQAPEGQPRLDQGSGASAEDAA
VQEERDAGVLSRVCGLLRQLHTAYSGLVSSLQGLPAELQQPVGRARHSLCELYGIVASAG
SVEELPAERLVQSREGVHQAWQGLEQLLEGLQHNPPLSWLVGPFALPAGGQ
NT seq 4116 nt   +upstreamnt  +downstreamnt
atgtctgctccagacgaagggagacgggatccccccaaaccgaagggcaagaccctgggc
agcttctttgggtccctgcctggcttcagctctgcccggaacctggtggccaacgcacat
agctcggcgagagcccggccggccgctgaccccacaggagcgcctgctgccgaggctgcc
caaccacaggctcaggtggctgcccacccagagcagacggccccatggacggagaaggag
ctgcaaccttcggaaaagatggtgtccggggccaaagacctggtgtgttccaagatgtcc
agggccaaggatgccgtgtcctccggggtggccagcgtggtggacgtggctaagggagtg
gtccagggaggcctggacaccactcggtctgcacttacgggcaccaaggaggtggtgtcc
agcggggtcacaggggccatggacatggctaagggggccgtccaagggggtctggacacc
tcgaaggctgtcctcaccggcaccaaggacacggtgtccactgggctcacgggggcagtg
aatgtggccaaagggaccgtacaggccggtgtggacaccaccaagactgtgctgaccggc
accaaagacacagtgactactggggtcatgggggcagtgaacttggccaaagggactgtc
cagactggcgtggaaacctccaaggctgtgctgaccggcaccaaagatgctgtgtccact
gggctcacaggggcagtgaatgtggccagaggaagcattcagaccggtgtggacaccagt
aagactgtcctaacaggtaccaaggacaccgtctgtagtggggtgactggtgccatgaat
gtggccaaaggaaccatccagaccggcgtggacaccagtaagactgtcctaacaggtacc
aaggacaccgtctgtagtggggtgactggtgccatgaatgtggccaaaggaaccatccag
accggcgtggacaccagtaagactgtcctaacaggtaccaaggacaccgtctgtagtggg
gtgactggtgccatgaatgtggccaaaggaaccatccagaccggcgtggacaccaccaag
actgtcctaactggcaccaagaacactgtctgcagtggggtgaccggtgccgtgaacttg
gccaaagaggccatccaggggggcctggataccaccaagtctatggtcatgggtacgaaa
gacacgatgtccactgggctcacaggggcagcgaatgtggccaagggggccatgcaaact
gggctgaacacaacccaaaatatcgcaacaggtacaaaggacaccgtctgcagtggggtg
actggtgccatgaatttggccagaggaaccatccagacaggcgtggacaccaccaagatc
gttctaactggtaccaaggacactgtctgcagtggggtcaccggtgctgcgaatgtggcc
aaaggggccgtccagggcggcctggacactacaaagtctgtcctgactggcactaaagat
gctgtgtccactgggctcacaggggctgtgaacgtggccaaagggaccgtccagaccggc
gtagacaccaccaagactgtcctaaccggcaccaaggacaccgtctgcagtggggtgacc
agtgctgtgaacgtggccaaaggggccgtccaggggggcctggacaccaccaagtctgtg
gtcataggtacaaaagacacgatgtccactgggctcacgggggcagcgaatgtggccaag
ggggctgtccagacaggtgtagacacagccaagaccgtgctgaccggcaccaaggacaca
gtgactactgggctcgtgggggcagtgaatgtcgccaaagggaccgtccagacaggcatg
gacaccaccaaaactgtcctaaccggtaccaaggacaccatctacagtggggtcaccagt
gccgtgaacgtggccaagggggctgtgcaaactgggctgaaaacgacccaaaatatcgcg
acaggtacaaagaacacctttggcagtggggtgaccagtgctgtgaatgtggccaaaggg
gctgcccagacaggtgtagacacggccaagaccgtgctgaccggcaccaaggacacagtc
actactgggctcatgggggcagtgaatgtcgccaaagggactgtccagaccagtgtggac
accaccaagactgtcctaactggtaccaaggacaccgtctgcagtggggtgaccggtgct
gcgaatgtggccaaaggggccatccaagggggcctggacactacaaagtctgtcctgact
ggcactaaagatgctgtgtccactgggctcacaggggctgtgaagttggccaaagggact
gtccagaccggcatggacaccaccaagactgtgttaactggtaccaaggatgctgtgtgc
agtggggtgaccggtgctgcgaatgtggccaagggggccgtccagatgggtgtagacacg
gccaagaccgtgctgaccggtaccaaggacactgtctgcagtggggtcaccggtgctgcg
aacgtggccaagggtgctgtgcaaactgggctgaaaacgacccaaaatatcgcaacaggt
acaaagaacacccttggcagtggggtgaccggtgctgcgaaagtggccaaaggggccgtc
caggggggcctggacactacaaagtctgtcctgactggcactaaagatgccgtgtccact
gggctcacaggggctgtgaacttggccaaagggactgtccagaccggcgtggacaccagc
aagactgtcctgaccggtaccaaggacaccgtctgcagtggagtcactggtgccgtaaat
gtggccaaagggaccgtccagacaggtgtggacacagccaagacggtgctgagtggcgct
aaggatgcagtgactactggagtcacgggggcagtgaatgtggccaaaggaaccgtgcag
accggcgtggacgcctccaaggctgtgcttatgggtaccaaggacactgtcttcagtggg
gttaccggtgccatgagcatggccaaaggggccgtccaggggggcctggacaccaccaag
acagtgctgaccggaaccaaagacgcagtgtccgctgggctcatggggtcagggaacgtg
gcgacaggggccacccacactggcctcagcaccttccagaactggttacctagtaccccc
gccacctcctggggtggactcaccagttccaggaccacagacaatggtggggagcagact
gccctgagcccccaagaggccccgttctctggcatctccacgcccccggatgtgctcagt
gtaggcccggagcctgcctgggaagccgcagccactaccaagggccttgcgactgacgtg
gcgacgttcacccaaggggccgccccaggcagggaggacacggggcttttggccaccaca
cacggccccgaagaagccccacgcttggcaatgctgcagaatgagttggaggggctgggg
gacatcttccaccccatgaatgcggaggagcaagctcagctggctgcctcccagcctggg
ccaaaggtgctgtcggcggaacaggggagctacttcgttcgtttaggtgacctgggtccc
agcttccgccagcgggcatttgaacacgcggtgagccacctgcagcacggccagttccaa
gccagggacactctggcccagctccaggactgcttcaggctgattgaaaaggcccagcag
gctccagaagggcagccacgtctggaccagggctcaggtgccagtgcggaggacgctgct
gtccaggaggagcgggatgccggggttctgtccagggtctgcggccttctccggcagctg
cacacggcctacagtggcctggtctccagcctccagggcctgcccgccgagctccagcag
ccagtggggcgggcgcggcacagcctctgtgagctctatggcatcgtggcctcagctggc
tctgtagaggagctgcccgcagagcggctggtgcagagccgcgagggtgtgcaccaggct
tggcaggggttagagcagctgctggagggcctacagcacaatcccccgctcagctggctg
gtagggcccttcgccttgcccgctggcgggcagtag

DBGET integrated database retrieval system