KEGG   Homo sapiens (human): 1230
Entry
1230              CDS       T01001                                 

Gene name
CCR1, CD191, CKR-1, CKR1, CMKBR1, HM145, MIP1aR, SCYAR1
Definition
(RefSeq) C-C motif chemokine receptor 1
  KO
K04176  C-C chemokine receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
  Element
N00212  KSHV vCCL2 to CCR signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01170  KSHV vCCL2 to CCR1 signaling
N01171  MOCV1 MC148 to CCR1 signaling
N01172  HHV6A vCCL4a to CCR1 signaling
Disease
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1230 (CCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1230 (CCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1230 (CCR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    1230 (CCR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1230 (CCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1230 (CCR1)
   04050 Cytokine receptors [BR:hsa04050]
    1230 (CCR1)
   04090 CD molecules [BR:hsa04090]
    1230 (CCR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1230 (CCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1230 (CCR1)
CD molecules [BR:hsa04090]
 Proteins
  1230 (CCR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1240
Other DBs
NCBI-GeneID: 1230
NCBI-ProteinID: NP_001286
OMIM: 601159
HGNC: 1602
Ensembl: ENSG00000163823
Vega: OTTHUMG00000133451
Pharos: P32246(Tchem)
UniProt: P32246 Q5U003
LinkDB
Position
3p21.31
AA seq 355 aa
METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggaaactccaaacaccacagaggactatgacacgaccacagagtttgactatggggat
gcaactccgtgccagaaggtgaacgagagggcctttggggcccaactgctgccccctctg
tactccttggtatttgtcattggcctggttggaaacatcctggtggtcctggtccttgtg
caatacaagaggctaaaaaacatgaccagcatctacctcctgaacctggccatttctgac
ctgctcttcctgttcacgcttcccttctggatcgactacaagttgaaggatgactgggtt
tttggtgatgccatgtgtaagatcctctctgggttttattacacaggcttgtacagcgag
atctttttcatcatcctgctgacgattgacaggtacctggccatcgtccacgccgtgttt
gccttgcgggcacggaccgtcacttttggtgtcatcaccagcatcatcatttgggccctg
gccatcttggcttccatgccaggcttatacttttccaagacccaatgggaattcactcac
cacacctgcagccttcactttcctcacgaaagcctacgagagtggaagctgtttcaggct
ctgaaactgaacctctttgggctggtattgcctttgttggtcatgatcatctgctacaca
gggattataaagattctgctaagacgaccaaatgagaagaaatccaaagctgtccgtttg
atttttgtcatcatgatcatcttttttctcttttggaccccctacaatttgactatactt
atttctgttttccaagacttcctgttcacccatgagtgtgagcagagcagacatttggac
ctggctgtgcaagtgacggaggtgatcgcctacacgcactgctgtgtcaacccagtgatc
tacgccttcgttggtgagaggttccggaagtacctgcggcagttgttccacaggcgtgtg
gctgtgcacctggttaaatggctccccttcctctccgtggacaggctggagagggtcagc
tccacatctccctccacaggggagcatgaactctctgctgggttctga

DBGET integrated database retrieval system