KEGG   Homo sapiens (human): 123099Help
Entry
123099            CDS       T01001                                 

Gene name
DEGS2, C14orf66, DES2, FADS8
Definition
(RefSeq) delta 4-desaturase, sphingolipid 2
  KO
K04712  sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    123099 (DEGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    123099 (DEGS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    123099 (DEGS2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     123099 (DEGS2)
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     123099 (DEGS2)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  Sphingolipid
   123099 (DEGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Lipid_DES
Motif
Other DBs
NCBI-GeneID: 123099
NCBI-ProteinID: NP_996801
OMIM: 610862
HGNC: 20113
Ensembl: ENSG00000168350
Vega: OTTHUMG00000171537
Pharos: Q6QHC5(Tbio)
UniProt: Q6QHC5
LinkDB All DBs
Position
14q32.2
AA seq 323 aa AA seqDB search
MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLACWL
VRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPY
AASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPK
AVTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGH
ETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDF
VFEDSLGPYARVKRVYRLAKDGL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacagcgcgagccgcagcgacttcgagtgggtctacaccgaccagccgcacacg
cagcggcgcaaggagatactggccaagtacccggccatcaaggccctgatgcggccagac
ccgcgcctcaagtgggcggtgctggtgctggtgctggtgcagatgctggcctgctggctg
gtgcgcgggctggcctggcgctggctgctgttctgggcctacgcctttggtggctgcgtg
aaccactcgctgacgctggccatccacgacatctcgcacaacgcggccttcggcacgggc
cgtgcggcacgcaaccgctggctggccgtgttcgccaacctgcccgtgggtgtgccctac
gccgcctccttcaagaagtaccacgtggaccaccaccgctacctgggcggcgacgggctg
gacgtggacgtgcccacgcgtctggagggctggttcttctgcacacccgcccgcaagctg
ctctggctggtgctgcagcccttcttctactcactacggccgctctgcgtccaccccaag
gccgtgacccgcatggaggtgctcaacacgctggtgcagctggcggccgacctggccatc
tttgccctttgggggctcaagcccgtggtctacctgctggccagctccttcctgggcctg
ggcctgcaccccatctcgggccacttcgtggccgagcactacatgttcctcaagggccac
gagacctactcctactatgggcctctcaactggatcaccttcaatgtgggctaccacgtg
gagcaccacgacttccccagcatcccgggctacaacctgccgctggtgcggaagatcgcg
cccgagtactacgaccacctgccgcagcaccactcctgggtgaaggtgctctgggatttt
gtgtttgaggactccctggggccctatgccagggtgaagcgggtgtacaggctggcaaaa
gatggtctgtga

KEGG   Homo sapiens (human): 8560Help
Entry
8560              CDS       T01001                                 

Gene name
DEGS1, DEGS, DEGS-1, DES1, Des-1, FADS7, HLD18, MIG15, MLD
Definition
(RefSeq) delta 4-desaturase, sphingolipid 1
  KO
K04712  sphingolipid 4-desaturase/C4-monooxygenase [EC:1.14.19.17 1.14.18.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Module
hsa_M00094  Ceramide biosynthesis
hsa_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    8560 (DEGS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    8560 (DEGS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    8560 (DEGS1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.5  sphingolipid C4-monooxygenase
     8560 (DEGS1)
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.17  sphingolipid 4-desaturase
     8560 (DEGS1)
Lipid biosynthesis proteins [BR:hsa01004]
 Desaturase
  Sphingolipid
   8560 (DEGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Lipid_DES
Motif
Other DBs
NCBI-GeneID: 8560
NCBI-ProteinID: NP_003667
OMIM: 615843
HGNC: 13709
Ensembl: ENSG00000143753
Vega: OTTHUMG00000037496
Pharos: O15121(Tbio)
UniProt: O15121 A0A024R3P1
LinkDB All DBs
Position
1q42.11
AA seq 323 aa AA seqDB search
MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYI
VKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPY
SISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPK
PITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGH
ETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDF
VMDDTISPYSRMKRHQKGEMVLE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggggagccgcgtctcgcgggaagacttcgagtgggtctacaccgaccagccgcacgcc
gaccggcgccgggagatcctggcaaagtatccagagataaagtccttgatgaaacctgat
cccaatttgatatggattataattatgatggttctcacccagttgggtgcattttacata
gtaaaagacttggactggaaatgggtcatatttggggcctatgcgtttggcagttgcatt
aaccactcaatgactctggctattcatgagattgcccacaatgctgcctttggcaactgc
aaagcaatgtggaatcgctggtttggaatgtttgctaatcttcctattgggattccatat
tcaatttcctttaagaggtatcacatggatcatcatcggtaccttggagctgatggcgtc
gatgtagatattcctaccgattttgagggctggttcttctgtaccgctttcagaaagttt
atatgggttattcttcagcctctcttttatgcctttcgacctctgttcatcaaccccaaa
ccaattacgtatctggaagttatcaataccgtggcacaggtcacttttgacattttaatt
tattactttttgggaattaaatccttagtctacatgttggcagcatctttacttggcctg
ggtttgcacccaatttctggacattttatagctgagcattacatgttcttaaagggtcat
gaaacttactcatattatgggcctctgaatttacttaccttcaatgtgggttatcataat
gaacatcatgatttccccaacattcctggaaaaagtcttccactggtgaggaaaatagca
gctgaatactatgacaacctccctcactacaattcctggataaaagtactgtatgatttt
gtgatggatgatacaataagtccctactcaagaatgaagaggcaccaaaaaggagagatg
gtgctggagtaa

DBGET integrated database retrieval system