KEGG   Homo sapiens (human): 1236Help
Entry
1236              CDS       T01001                                 

Gene name
CCR7, BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1
Definition
(RefSeq) C-C motif chemokine receptor 7
  KO
K04182  C-C chemokine receptor type 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1236 (CCR7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1236 (CCR7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    1236 (CCR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1236 (CCR7)
   04050 Cytokine receptors [BR:hsa04050]
    1236 (CCR7)
   04090 CD molecules [BR:hsa04090]
    1236 (CCR7)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    1236 (CCR7)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   1236 (CCR7)
CD molecules [BR:hsa04090]
 Proteins
  1236 (CCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Motif
Other DBs
NCBI-GeneID: 1236
NCBI-ProteinID: NP_001829
OMIM: 600242
HGNC: 1608
Ensembl: ENSG00000126353
Vega: OTTHUMG00000133375
Pharos: P32248(Tbio)
UniProt: P32248 A0N0Q0
LinkDB All DBs
Position
17q21.2
AA seq 378 aa AA seqDB search
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH
IRRSSMSVEAETTTTFSP
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacctggggaaaccaatgaaaagcgtgctggtggtggctctccttgtcattttccag
gtatgcctgtgtcaagatgaggtcacggacgattacatcggagacaacaccacagtggac
tacactttgttcgagtctttgtgctccaagaaggacgtgcggaactttaaagcctggttc
ctccctatcatgtactccatcatttgtttcgtgggcctactgggcaatgggctggtcgtg
ttgacctatatctatttcaagaggctcaagaccatgaccgatacctacctgctcaacctg
gcggtggcagacatcctcttcctcctgacccttcccttctgggcctacagcgcggccaag
tcctgggtcttcggtgtccacttttgcaagctcatctttgccatctacaagatgagcttc
ttcagtggcatgctcctacttctttgcatcagcattgaccgctacgtggccatcgtccag
gctgtctcagctcaccgccaccgtgcccgcgtccttctcatcagcaagctgtcctgtgtg
ggcatctggatactagccacagtgctctccatcccagagctcctgtacagtgacctccag
aggagcagcagtgagcaagcgatgcgatgctctctcatcacagagcatgtggaggccttt
atcaccatccaggtggcccagatggtgatcggctttctggtccccctgctggccatgagc
ttctgttaccttgtcatcatccgcaccctgctccaggcacgcaactttgagcgcaacaag
gccatcaaggtgatcatcgctgtggtcgtggtcttcatagtcttccagctgccctacaat
ggggtggtcctggcccagacggtggccaacttcaacatcaccagtagcacctgtgagctc
agtaagcaactcaacatcgcctacgacgtcacctacagcctggcctgcgtccgctgctgc
gtcaaccctttcttgtacgccttcatcggcgtcaagttccgcaacgatctcttcaagctc
ttcaaggacctgggctgcctcagccaggagcagctccggcagtggtcttcctgtcggcac
atccggcgctcctccatgagtgtggaggccgagaccaccaccaccttctccccatag

DBGET integrated database retrieval system