KEGG   Homo sapiens (human): 124Help
Entry
124               CDS       T01001                                 

Gene name
ADH1A, ADH1
Definition
(RefSeq) alcohol dehydrogenase 1A (class I), alpha polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Drug target
Fomepizole: D00707
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    124 (ADH1A)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    124 (ADH1A)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    124 (ADH1A)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    124 (ADH1A)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    124 (ADH1A)
   00982 Drug metabolism - cytochrome P450
    124 (ADH1A)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    124 (ADH1A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     124 (ADH1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 124
NCBI-ProteinID: NP_000658
OMIM: 103700
HGNC: 249
Ensembl: ENSG00000187758
Vega: OTTHUMG00000131026
Pharos: P07327(Tclin)
UniProt: P07327
LinkDB All DBs
Structure
PDB: 

Position
4q23
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAVGICGTDDHVVSGTMVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLAIPQCGKCRICKNPESNYCLKNDVSNP
QGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAIMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTILMF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtggaggttgcacctcctaaggcccatgaagttcgtattaag
atggtggctgtaggaatctgtggcacagatgaccacgtggttagtggtaccatggtgacc
ccacttcctgtgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccactcgctattcctcagtgtggaaaa
tgcagaatttgtaaaaacccggagagcaactactgcttgaaaaacgatgtaagcaatcct
caggggaccctgcaggatggcaccagcaggttcacctgcaggaggaagcccatccaccac
ttccttggcatcagcaccttctcacagtacacagtggtggatgaaaatgcagtagccaaa
attgatgcagcctcgcctctagagaaagtctgtctcattggctgtggattttcaactggt
tatgggtctgcagtcaatgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctattatgggctgtaaagcagctggggcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccatccaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcatttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagtgtcatcgtaggggtacctcctgattcccaa
aacctctcaatgaaccctatgctgctactgactggacgtacctggaagggagctattctt
ggtggctttaaaagtaaagaatgtgtcccaaaacttgtggctgattttatggctaagaag
ttttcattggatgcattaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccattctgatgttttga

KEGG   Homo sapiens (human): 125Help
Entry
125               CDS       T01001                                 

Gene name
ADH1B, ADH2, HEL-S-117
Definition
(RefSeq) alcohol dehydrogenase 1B (class I), beta polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Disease
H01611  Alcohol dependence
Drug target
Fomepizole: D00707
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    125 (ADH1B)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    125 (ADH1B)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    125 (ADH1B)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    125 (ADH1B)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    125 (ADH1B)
   00982 Drug metabolism - cytochrome P450
    125 (ADH1B)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    125 (ADH1B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     125 (ADH1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 125
NCBI-ProteinID: NP_000659
OMIM: 103720
HGNC: 250
Ensembl: ENSG00000196616
Vega: OTTHUMG00000161413
Pharos: P00325(Tclin)
UniProt: P00325 V9HW50
LinkDB All DBs
Structure
PDB: 

Position
4q23
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDDHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNP
RGTLQDGTRRFTCRGKPIHHFLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVNVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPASQ
NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHVLPFEKINEGF
DLLHSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggaggtaaagaaa
cccttttccattgaggatgtggaggttgcacctcctaaggcttatgaagttcgcattaag
atggtggctgtaggaatctgtcacacagatgaccacgtggttagtggcaacctggtgacc
ccccttcctgtgattttaggccatgaggcagccggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagagtttgtaaaaacccggagagcaactactgcttgaaaaatgatctaggcaatcct
cgggggaccctgcaggatggcaccaggaggttcacctgcagggggaagcccattcaccac
ttccttggcaccagcaccttctcccagtacacggtggtggatgagaatgcagtggccaaa
attgatgcagcctcgcccctggagaaagtctgcctcattggctgtggattctcgactggt
tatgggtctgcagttaacgttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctgttatgggctgtaaagcagctggagcagccagaatc
attgcggtggacatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaagtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagcgtcatcgtaggggtacctcctgcttcccag
aacctctcaataaaccctatgctgctactgactggacgcacctggaagggggctgtttat
ggtggctttaagagtaaagaaggtatcccaaaacttgtggctgattttatggctaagaag
ttttcactggatgcgttaataacccatgttttaccttttgaaaaaataaatgaaggattt
gacctgcttcactctgggaaaagtatccgtaccgtcctgacgttttga

KEGG   Homo sapiens (human): 126Help
Entry
126               CDS       T01001                                 

Gene name
ADH1C, ADH3
Definition
(RefSeq) alcohol dehydrogenase 1C (class I), gamma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Disease
H01611  Alcohol dependence
Drug target
Fomepizole: D00707
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    126 (ADH1C)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    126 (ADH1C)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    126 (ADH1C)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    126 (ADH1C)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    126 (ADH1C)
   00982 Drug metabolism - cytochrome P450
    126 (ADH1C)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    126 (ADH1C)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     126 (ADH1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C UDPG_MGDP_dh_N ADH_zinc_N_2 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 126
NCBI-ProteinID: NP_000660
OMIM: 103730
HGNC: 251
Ensembl: ENSG00000248144
Vega: OTTHUMG00000161422
Pharos: P00326(Tclin)
UniProt: P00326
LinkDB All DBs
Structure
PDB: 

Position
4q23
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVT
PLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNP
RGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGF
DLLRSGKSIRTVLTF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcaggaaaagtaatcaaatgcaaagcagctgtgctatgggagttaaagaaa
cccttttccattgaggaggtagaggttgcacctcctaaggctcatgaagttcgcattaag
atggtggctgcaggaatctgtcgttcagatgagcatgtggttagtggcaacctggtgacc
ccccttcctgtgattttaggccatgaggcagccggcatcgtggaaagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccgctctttactcctcagtgtggaaaa
tgcagaatttgtaaaaacccagaaagcaactactgcttgaaaaatgatctaggcaatcct
cgggggaccctgcaggatggcaccaggaggttcacctgcagcgggaagcccatccaccac
ttcgtcggcgtcagcaccttctcccagtacacagtggtggatgagaatgcagtggccaaa
attgatgcagcctcgcccctggagaaagtctgcctcattggctgtggattttcgactggt
tatgggtctgcagtcaaagttgccaaggtcaccccagggtctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgttgttatgggctgtaaagcagctggagcagccagaatc
attgctgtggacatcaacaaggacaaatttgcaaaggctaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaagtgctaaaggaaatgactgat
ggaggtgtggatttttcgtttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagtgtcattgtaggggtacctcctgattcccag
aacctctcaataaaccctatgctgctactgactggacgcacgtggaaaggagctattttt
ggaggctttaagagtaaagaatctgtccccaaacttgtggctgactttatggctaagaag
ttttcactggatgcattaataacaaatattttaccttttgaaaaaataaatgaaggattt
gacctgcttcgctctggaaagagtatccgtaccgtcctgacgttttga

KEGG   Homo sapiens (human): 127Help
Entry
127               CDS       T01001                                 

Gene name
ADH4, ADH-2, HEL-S-4
Definition
(RefSeq) alcohol dehydrogenase 4 (class II), pi polypeptide
  KO
K13980  alcohol dehydrogenase 4 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    127 (ADH4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    127 (ADH4)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    127 (ADH4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    127 (ADH4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    127 (ADH4)
   00982 Drug metabolism - cytochrome P450
    127 (ADH4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    127 (ADH4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     127 (ADH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 UDPG_MGDP_dh_N Glu_dehyd_C Thioredoxin
Motif
Other DBs
NCBI-GeneID: 127
NCBI-ProteinID: NP_000661
OMIM: 103740
HGNC: 252
Ensembl: ENSG00000198099
Vega: OTTHUMG00000161227
Pharos: P08319(Tbio)
UniProt: P08319 V9HVX7
LinkDB All DBs
Structure
PDB: 

Position
4q23
AA seq 380 aa AA seqDB search
MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEG
LAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLK
SPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGC
GFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKA
LGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGV
AAGSKGLTIFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDK
ISEAFDLMNQGKSVRTILIF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccaagggcaaagttattaaatgcaaagcagccatcgcctgggaagcaggcaag
cccctttgcattgaagaggttgaagtagctccccccaaggctcatgaagttcgcattcag
atcattgctacctctctgtgccatactgatgccactgttatcgattctaaatttgagggc
ctagctttcccagtgatcgttggccatgaggctgcaggtattgtggaaagtattgggcca
ggagtgaccaacgtcaaaccaggtgacaaagtaattccactttatgcacctctatgtaga
aaatgcaagttttgtctgagtccactcacaaatttgtgtgggaaaatcagtaatctcaaa
agtcctgctagtgatcaacaactaatggaagacaaaaccagcaggtttacctgcaaagga
aaaccagtttaccatttctttggaaccagtacattctctcagtacactgtggtgtcagat
atcaatcttgccaaaatagatgatgatgcaaatttagagagagtttgtctgcttggatgt
gggttttcaactggctatggggctgcaatcaacaatgccaaggtcacccctggttcgact
tgtgctgtctttggcctaggaggtgtgggtctttctgctgtaatgggttgtaaagcagca
ggagcttccagaatcataggtattgacatcaacagtgagaagtttgtgaaggctaaagcc
ctgggagccactgactgcctcaatcctagagacttacataaaccgatccaggaagttatc
attgaattgaccaagggaggtgtggattttgcccttgactgtgcaggtggatctgaaacc
atgaaagcagccctggactgtacaaccgcaggctggggatcatgtactttcattggagta
gctgctggtagcaaaggattgactatttttccagaggagctaataatcggccgtactata
aatggaacattctttggtggttggaaaagtgtagattctatcccaaagctggtcactgac
tataagaataagaaattcaatctggatgcactggtgacccataccctgccttttgacaaa
atcagtgaggcatttgacctaatgaaccaaggaaaaagcgtccgaacaatcctcatcttt
tga

KEGG   Homo sapiens (human): 128Help
Entry
128               CDS       T01001                                 

Gene name
ADH5, ADH-3, ADHX, FALDH, FDH, GSH-FDH, GSNOR, HEL-S-60p
Definition
(RefSeq) alcohol dehydrogenase 5 (class III), chi polypeptide
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    128 (ADH5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    128 (ADH5)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    128 (ADH5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    128 (ADH5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    128 (ADH5)
   00982 Drug metabolism - cytochrome P450
    128 (ADH5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    128 (ADH5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     128 (ADH5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     128 (ADH5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 128
NCBI-ProteinID: NP_000662
OMIM: 103710
HGNC: 253
Ensembl: ENSG00000197894
Vega: OTTHUMG00000161230
Pharos: P11766(Tbio)
UniProt: P11766 Q6IRT1
LinkDB All DBs
Structure
PDB: 

Position
4q23
AA seq 374 aa AA seqDB search
MANEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGC
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY
GAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFARAKEFGATEC
INPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEE
IATRPFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDEFVTHNLSFDEINKAFE
LMHSGKSIRTVVKI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaggttatcaagtgcaaggctgcagttgcttgggaggctggaaagcctctc
tccatagaggagatagaggtggcacccccaaaggctcatgaagttcgaatcaagatcatt
gccactgcggtttgccacaccgatgcctataccctgagtggagctgatcctgagggttgt
tttccagtgatcttgggacatgaaggtgctggaattgtggaaagtgttggtgagggagtt
actaagctgaaggcgggtgacactgtcatcccactttacatcccacagtgtggagaatgc
aaattttgtctaaatcctaaaactaacctttgccagaagataagagtcactcaagggaaa
ggattaatgccagatggtaccagcagatttacttgcaaaggaaagacaattttgcattac
atgggaaccagcacattttctgaatacacagttgtggctgatatctctgttgctaaaata
gatcctttagcacctttggataaagtctgccttctaggttgtggcatttcaaccggttat
ggtgctgctgtgaacactgccaagttggagcctggctctgtttgtgccgtctttggtctg
ggaggagtcggattggcagttatcatgggctgtaaagtggctggtgcttcccggatcatt
ggtgtggacatcaataaagataaatttgcaagggccaaagagtttggagccactgaatgt
attaaccctcaggattttagtaaacccatccaggaagtgctcattgagatgaccgatgga
ggagtggactattcctttgaatgtattggtaatgtgaaggtcatgagagcagcacttgag
gcatgtcacaagggctggggcgtcagcgtcgtggttggagtagctgcttcaggtgaagaa
attgccactcgtccattccagctggtaacaggtcgcacatggaaaggcactgcctttgga
ggatggaagagtgtagaaagtgtcccaaagttggtgtctgaatatatgtccaaaaagata
aaagttgatgaatttgtgactcacaatctgtcttttgatgaaatcaacaaagcctttgaa
ctgatgcattctggaaagagcattcgaactgttgtaaagatttaa

KEGG   Homo sapiens (human): 130Help
Entry
130               CDS       T01001                                 

Gene name
ADH6, ADH-5
Definition
(RefSeq) alcohol dehydrogenase 6 (class V)
  KO
K13952  alcohol dehydrogenase 6 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    130 (ADH6)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    130 (ADH6)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    130 (ADH6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    130 (ADH6)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    130 (ADH6)
   00982 Drug metabolism - cytochrome P450
    130 (ADH6)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    130 (ADH6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     130 (ADH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 UDPG_MGDP_dh_N IGFBP 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 130
NCBI-ProteinID: NP_000663
OMIM: 103735
HGNC: 255
Ensembl: ENSG00000172955
Vega: OTTHUMG00000131024
Pharos: P28332(Tbio)
UniProt: P28332 Q8IUN7
LinkDB All DBs
Position
4q23
AA seq 368 aa AA seqDB search
MSTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLD
LLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSK
TQLMSDGTSRFTCKGKSIYHFGNTSTFCEYTVIKEISVAKIDAVAPLEKVCLISCGFSTG
FGAAINTAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDVNKEKFKKAQELGATE
CLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAALASCNESYGVCVVVGVLPASV
QLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHTLNLDKINEAV
ELMKTGKW
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtactacaggccaagtcatcagatgcaaagcagccatactctggaagcctggtgca
ccattttctattgaagaggtagaagtggccccaccaaaggcaaaggaagttcgcataaag
gttgtggccaccggactgtgtggtacagagatgaaagtgttggggagtaaacacttggac
ctcttgtatcccaccatcttgggccatgaaggggctggaatcgttgagagtattggagaa
ggagtaagcacagtgaaaccaggtgacaaagttatcacactctttctgccacagtgtgga
gaatgtacctcttgcctgaattctgagggcaatttttgtatacaattcaaacagtcaaaa
acccaactgatgtctgatggtaccagcaggtttacctgcaagggaaaatcaatatatcac
tttggtaataccagcaccttctgtgaatacacagtgataaaggaaatctcagttgccaag
attgatgcagtcgctcctctagagaaagtatgcctaattagctgtggcttttccactggg
tttggtgctgcaatcaatactgccaaggtgactccaggttctacctgtgctgtgtttggc
ctgggaggagtcggcttgtctgttgtcatgggttgtaaagcagcaggagcagccaggatc
attggagtggatgtcaacaaggagaaatttaagaaggcacaggaattgggtgctactgag
tgcctcaaccctcaggacttaaagaaacccattcaagaagttttatttgatatgacagat
gctggtatagacttctgctttgaggccattggaaatctggacgttctggcagctgccctc
gcctcctgcaatgagagctatggggtctgtgtggttgttggggtgttgcctgccagtgtt
caactcaaaatcagtggccagttgttcttctcaggacgttctttgaagggttctgttttt
ggaggctggaagagcagacagcacatccctaaactggttgctgattatatggcagagaag
ttgaatctagatccactaattactcatactctgaatcttgataaaatcaatgaagcagtt
gaattaatgaaaactggaaaatggtaa

KEGG   Homo sapiens (human): 131Help
Entry
131               CDS       T01001                                 

Gene name
ADH7, ADH4
Definition
(RefSeq) alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00071  Fatty acid degradation
hsa00350  Tyrosine metabolism
hsa00830  Retinol metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    131 (ADH7)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    131 (ADH7)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    131 (ADH7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    131 (ADH7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    131 (ADH7)
   00982 Drug metabolism - cytochrome P450
    131 (ADH7)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    131 (ADH7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     131 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 131
NCBI-ProteinID: NP_000664
OMIM: 600086
HGNC: 256
Ensembl: ENSG00000196344
Vega: OTTHUMG00000159318
Pharos: P40394(Tchem)
UniProt: P40394
LinkDB All DBs
Structure
PDB: 

Position
4q23
AA seq 386 aa AA seqDB search
MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICR
TDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPD
GNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEK
VCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDK
FEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITH
VLPFKKISEGFELLNSGQSIRTVLTF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagaaatacagatccaagacaaagacaggatgggcactgctggaaaagttatt
aaatgcaaagcagctgtgctttgggagcagaagcaacccttctccattgaggaaatagaa
gttgccccaccaaagactaaagaagttcgcattaagattttggccacaggaatctgtcgc
acagatgaccatgtgataaaaggaacaatggtgtccaagtttccagtgattgtgggacat
gaggcaactgggattgtagagagcattggagaaggagtgactacagtgaaaccaggtgac
aaagtcatccctctctttctgccacaatgtagagaatgcaatgcttgtcgcaacccagat
ggcaacctttgcattaggagcgatattactggtcgtggagtactggctgatggcaccacc
agatttacatgcaagggcaaaccagtccaccacttcatgaacaccagtacatttaccgag
tacacagtggtggatgaatcttctgttgctaagattgatgatgcagctcctcctgagaaa
gtctgtttaattggctgtgggttttccactggatatggcgctgctgttaaaactggcaag
gtcaaacctggttccacttgcgtcgtctttggcctgggaggagttggcctgtcagtcatc
atgggctgtaagtcagctggtgcatctaggatcattgggattgacctcaacaaagacaaa
tttgagaaggccatggctgtaggtgccactgagtgtatcagtcccaaggactctaccaaa
cccatcagtgaggtgctgtcagaaatgacaggcaacaacgtgggatacacctttgaagtt
attgggcatcttgaaaccatgattgatgccctggcatcctgccacatgaactatgggacc
agcgtggttgtaggagttcctccatcagccaagatgctcacctatgacccgatgttgctc
ttcactggacgcacatggaagggatgtgtctttggaggtttgaaaagcagagatgatgtc
ccaaaactagtgactgagttcctggcaaagaaatttgacctggaccagttgataactcat
gttttaccatttaaaaaaatcagtgaaggatttgagctgctcaattcaggacaaagcatt
cgaacggtcctgacgttttga

DBGET integrated database retrieval system