KEGG   Homo sapiens (human): 1258Help
Entry
1258              CDS       T01001                                 

Gene name
CNGB1, CNCG2, CNCG3L, CNCG4, CNG4, CNGB1B, GAR1, GARP, GARP2, RCNC2, RCNCb, RCNCbeta, RP45
Definition
(RefSeq) cyclic nucleotide gated channel subunit beta 1
  KO
K04952  cyclic nucleotide gated channel beta 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1258 (CNGB1)
   04022 cGMP-PKG signaling pathway
    1258 (CNGB1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    1258 (CNGB1)
   04740 Olfactory transduction
    1258 (CNGB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1258 (CNGB1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1258 (CNGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Npa1
Motif
Other DBs
NCBI-GeneID: 1258
NCBI-ProteinID: NP_001288
OMIM: 600724
HGNC: 2151
Ensembl: ENSG00000070729
Vega: OTTHUMG00000154810
Pharos: Q14028(Tbio)
UniProt: Q14028
LinkDB All DBs
Position
16q21
AA seq 1251 aa AA seqDB search
MLGWVQRVLPQPPGTPRKTKMQEEEEVEPEPEMEAEVEPEPNPEEAETESESMPPEESFK
EEEVAVADPSPQETKEAALTSTISLRAQGAEISEMNSPSRRVLTWLMKGVEKVIPQPVHS
ITEDPAQILGHGSTGDTGCTDEPNEALEAQDTRPGLRLLLWLEQNLERVLPQPPKSSEVW
RDEPAVATGAASDPAPPGRPQEMGPKLQARETPSLPTPIPLQPKEEPKEAPAPEPQPGSQ
AQTSSLPPTRDPARLVAWVLHRLEMALPQPVLHGKIGEQEPDSPGICDVQTISILPGGQV
EPDLVLEEVEPPWEDAHQDVSTSPQGTEVVPAYEEENKAVEKMPRELSRIEEEKEDEEEE
EEEEEEEEEEEVTEVLLDSCVVSQVGVGQSEEDGTRPQSTSDQKLWEEVGEEAKKEAEEK
AKEEAEEVAEEEAEKEPQDWAETKEEPEAEAEAASSGVPATKQHPEVQVEDTDADSCPLM
AEENPPSTVLPPPSPAKSDTLIVPSSASGTHRKKLPSEDDEAEELKALSPAESPVVAWSD
PTTPKDTDGQDRAASTASTNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKP
SPAKKAPEPAPDTKPAEAEPVEEEHYCDMLCCKFKHRPWKKYQFPQSIDPLTNLMYVLWL
FFVVMAWNWNCWLIPVRWAFPYQTPDNIHHWLLMDYLCDLIYFLDITVFQTRLQFVRGGD
IITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRCLKYMAFFEFNSRLE
SILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYDGVGNSYIRCYYFAV
KTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDST
VKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKV
ALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLV
TLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKA
RRMLRSNNKPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGKLAHLRARLKELA
ALEAAAKQQELVEQAKSSQDVKGEEGSAAPDQHTHPKEAATDPPAPRTPPEPPGSPPSSP
PPASLGRPEGEEEGPAEPEEHSVRICMSPGPEPGEQILSVKMPEEREEKAE
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
atgttgggctgggtccagagggtgctgcctcagcccccagggacccctcggaagaccaag
atgcaggaggaagaggaagtggaaccagagccagagatggaggcggaggtggaaccagaa
ccgaatcctgaggaggccgagacagagtccgagtccatgccccccgaagagtcattcaag
gaggaggaagtggctgtggcagacccaagccctcaggagaccaaggaggctgcccttact
tccaccatatccctccgggcccagggcgctgagatttctgaaatgaatagtcccagccgc
agggtactgacctggctcatgaagggcgtagagaaggtgatcccgcagcctgttcacagc
atcacggaggacccggctcagatcctggggcatggcagcactggggacacagggtgcaca
gatgaacccaatgaggcccttgaggcccaagacactaggcctgggctgcggctgcttctg
tggctggagcagaatctggaaagagtgcttcctcagccccccaaatcctctgaggtctgg
agagatgagcctgcagttgctacaggtgctgcctcagacccagcgcctccaggacgcccc
caggaaatggggcccaagctgcaggcccgggagaccccctccctgcccacacccatcccc
ctgcagcccaaggaggaacccaaggaggcaccagctccagagccccagcccggctcccag
gcccagacctcctccctgccaccaaccagggaccctgccaggctggtggcatgggtcctg
cacaggctggagatggccttgccgcagccagtgctacatgggaaaataggggaacaggag
cctgactcccctgggatatgtgatgtgcagaccatcagcatccttcctggaggacaagtg
gagcctgaccttgtcctagaggaggttgaaccgccctgggaggatgcccaccaggatgtc
agtaccagcccacagggtacagaggtggttccagcttatgaagaagagaacaaagctgtg
gagaagatgcccagagagctgtcccggattgaagaggagaaagaagatgaggaggaggaa
gaggaagaggaggaggaggaggaagaggaggaggtgactgaggtgctgctggatagctgt
gtggtgtcgcaggtgggcgtgggccagagtgaagaagacgggacccggccccagagcact
tcagatcagaagctgtgggaggaagttggggaggaggccaagaaggaggctgaagagaag
gccaaggaggaggccgaggaggtggctgaagaggaggctgaaaaggagccccaggactgg
gcggagaccaaggaggagcctgaggctgaggccgaggctgccagttcaggagtgcctgcc
acgaaacagcacccagaagtgcaggtggaagatactgatgctgatagctgccccctcatg
gcagaagagaatccaccctcaaccgtgttgccgccaccgtctcctgccaaatcagacacc
cttatagtcccaagctcagcctcggggacacacaggaagaagctgccctctgaggatgat
gaggctgaagagctcaaggcgttgtcaccagcagagtccccagtggttgcctggtctgac
cccaccaccccgaaggacactgatggccaggaccgtgcggcctccacggccagcacaaat
agcgccatcatcaacgaccggctccaggagctggtgaagctcttcaaggagcggacagag
aaagtgaaggagaaactcattgaccctgacgtcacctctgatgaggagagccccaagccc
tccccagccaagaaagccccagagccagctccagacacaaagcccgctgaagccgagcca
gtggaagaggagcactattgcgacatgctctgctgcaagttcaaacaccgcccctggaag
aagtaccagtttccccagagcattgacccgctgaccaacctgatgtatgtcctatggctg
ttcttcgtggtgatggcctggaattggaactgttggctgattcccgtgcgctgggccttc
ccctaccagaccccggacaacatccaccactggctgctgatggattacctatgcgacctc
atctacttcctggacatcaccgtgttccagacacgcctgcagtttgtcagaggcggggac
atcattacggacaaaaaggacatgcgaaataactacctgaagtctcgccgcttcaagatg
gacctgctcagcctcctgcccttggattttctctatttgaaagtcggtgtgaaccccctc
ctccgcctgccccgctgtttaaagtacatggccttcttcgagtttaacagccgcctggaa
tccatcctcagcaaagcctacgtgtacagggtcatcaggaccacagcctaccttctctac
agcctgcatttgaattcctgtctttattactgggcatcggcctatcagggcctcggctcc
actcactgggtttacgatggcgtgggaaacagttatattcgctgttactactttgctgtg
aagaccctcatcaccatcggggggctgcctgaccccaagacactctttgaaattgtcttc
cagctgctgaattatttcacgggcgtctttgctttctctgtgatgatcggacagatgaga
gatgtggtaggggccgccaccgccggacagacctactaccgcagctgcatggacagcacg
gtgaagtacatgaatttctacaagatccccaagtccgtgcagaaccgcgtcaagacctgg
tacgagtacacctggcactcgcaaggcatgctggatgagtcagagctgatggtgcagctt
ccagacaagatgcggctggacctcgccatcgacgtgaactacaacatcgttagcaaagtc
gcactctttcagggctgtgaccggcagatgatctttgacatgctgaagaggcttcgctct
gttgtctacctgcccaacgactatgtgtgcaagaagggggagatcggccgtgagatgtac
atcatccaggcagggcaagtgcaggtcttgggcggccctgatgggaaatctgtgctggtg
acgctgaaagctggatctgtgtttggagaaataagcttgctggctgttgggggcgggaac
cggcgcacggccaacgtggtggcgcacgggtttaccaacctcttcatcctggataagaag
gacctgaatgagattttggtgcattatcctgagtctcagaagttactccggaagaaagcc
aggcgcatgctgagaagcaacaataagcccaaggaggagaagagcgtgctgatccttcca
ccccgggcgggcaccccaaagctcttcaacgctgccctcgctatgacaggaaagatgggt
ggcaagggggcaaaaggcggcaaacttgctcacctccgggcccggctcaaagaactggcc
gcgctggaggcggctgcaaagcagcaagagttggtggaacaggccaagagctcgcaagac
gtcaagggagaggaaggctccgccgccccagaccagcacacgcacccaaaggaggccgcc
accgacccacccgcgccccggacgccccccgagcccccggggtctccaccgagctctcca
ccgcctgcctcccttgggaggccggagggagaggaggaggggccggccgagcccgaagag
cactcggtgaggatctgcatgagcccgggcccggagccgggagagcagatcctgtcggtg
aagatgccggaggaaagggaggagaaggcggagtaa

KEGG   Homo sapiens (human): 1259Help
Entry
1259              CDS       T01001                                 

Gene name
CNGA1, CNCG, CNCG1, CNG-1, CNG1, RCNC1, RCNCa, RCNCalpha, RP49
Definition
(RefSeq) cyclic nucleotide gated channel subunit alpha 1
  KO
K04948  cyclic nucleotide gated channel alpha 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1259 (CNGA1)
   04022 cGMP-PKG signaling pathway
    1259 (CNGA1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    1259 (CNGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1259 (CNGA1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1259 (CNGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CLZ cNMP_binding DDHD SpoIIIAH Connexin Ion_trans_2 Zip Tim54 MCU RNA_polI_A34 DUF913 NPR3 DUF4746 SLC12 Eapp_C RR_TM4-6 DUF2828 Sec62 DUF2370 EMC3_TMCO1 FGF-BP1 CLN3 MCM_bind FancD2
Motif
Other DBs
NCBI-GeneID: 1259
NCBI-ProteinID: NP_000078
OMIM: 123825
HGNC: 2148
Ensembl: ENSG00000198515
Vega: OTTHUMG00000160668
Pharos: P29973(Tbio)
UniProt: P29973 A0A024R9X3
LinkDB All DBs
Position
4p12
AA seq 690 aa AA seqDB search
MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENP
HARGSFSYKSLRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEKKKKKKEKKSKSDDKN
ENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNW
TMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKY
KSNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRI
SNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTL
TTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQY
MHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIF
ADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSD
GSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGK
QILMKDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLT
KVEKFLKPLIDTEFSSIEGPGAESGPIDST
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatccatgaagaacaatattatcaatacacagcagtcttttgtaaccatgccc
aatgtgattgtaccagatattgaaaaggaaatacgaaggatggaaaatggagcatgcagc
tccttttctgaggatgatgacagtgcctctacatctgaagaatcagagaatgaaaaccct
catgcaaggggttcctttagttataagtcactcagaaagggaggaccatcacagagggag
cagtacctgcctggtgccattgcactttttaatgtgaacaacagcagcaataaggaccag
gaaccagaagaaaaaaagaaaaagaaaaaagaaaagaagagcaagtcagatgataaaaac
gaaaataaaaacgacccagagaagaaaaagaagaaaaaggacaaagagaagaaaaagaaa
gaggagaaaagcaaagataagaaagaagaggagaagaaagaagttgtggttattgatccc
tcgggaaacacatattacaactggctgttttgcatcacattacctgttatgtacaactgg
acaatggttattgccagagcatgttttgatgaacttcaatctgattacctagaatattgg
ctcattttggattacgtatcagacatagtctatttaatcgatatgtttgtacgaacaagg
acaggttacctagaacaaggactgctggtaaaggaagaacttaaactcataaataaatat
aaatccaacttgcaatttaaacttgatgttctgtcactgataccaactgatttgctgtat
tttaagttagggtggaactatccagaaattagattaaacaggttgttacggttctctcgt
atgtttgagttcttccagagaacagaaacaaggacaaactatccaaacatcttcaggatt
tccaaccttgttatgtatatcgtcatcattatccactggaatgcatgtgtgttctactct
atttctaaagctattggatttggaaatgatacatgggtctaccctgatattaatgatcct
gaatttggccgtttggctagaaaatacgtatacagcctttactggtctacactgactttg
actaccattggtgaaacaccccctcccgtgagggattctgagtatgtctttgtggtggtt
gatttcctaattggagtgttaatttttgctaccatcgttggtaacataggttctatgatt
tccaacatgaatgcagccagagcagaatttcaagcaagaattgatgctatcaagcaatat
atgcattttcgaaatgtaagcaaagatatggaaaagagggttattaaatggtttgactac
ctgtggaccaacaaaaaaacagttgatgagaaagaagtcttaaagtatctacctgataaa
ctaagagcagaaattgccatcaacgttcacttagacacattaaaaaaggtacgcattttt
gctgattgtgaagctggtctgttggtggagttggtcttgaaattgcaaccccaagtctac
agtcctggagattatatttgcaagaaaggggatatcggacgagagatgtacattatcaag
gaaggcaaactcgctgtggtggcagatgatggagtcactcagtttgtggtattgagcgat
ggcagctacttcggtgagatcagcattcttaacattaaagggagcaaagctggcaatcga
agaacggccaatattaaaagtattggctactcagacctgttctgtctctcaaaagatgac
ctcatggaagctctaactgagtacccagatgccaaaactatgctggaagagaaagggaag
cagattttaatgaaagatggtctactggatctaaacattgcaaatgctggcagtgatcct
aaagatcttgaagagaaggttactcgaatggaggggtcagtagacctcctgcaaaccagg
tttgcccgaatcttggctgagtatgagtccatgcagcagaaactgaaacaaagattaacc
aaggttgagaaatttctgaaaccgcttattgacacagaattttcaagtattgagggacct
ggagcggaaagtgggcccatcgactctacatag

DBGET integrated database retrieval system