KEGG   Homo sapiens (human): 126375Help
Entry
126375            CDS       T01001                                 

Gene name
ZNF792
Definition
(RefSeq) zinc finger protein 792
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    126375 (ZNF792)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    126375 (ZNF792)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    126375 (ZNF792)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_11 zf-C2H2_jaz C1_1 zinc_ribbon_15 Zn-ribbon_8 GAGA
Motif
Other DBs
NCBI-GeneID: 126375
NCBI-ProteinID: NP_787068
HGNC: 24751
Ensembl: ENSG00000180884
Vega: OTTHUMG00000150339
Pharos: Q3KQV3(Tdark)
UniProt: Q3KQV3
LinkDB All DBs
Position
19q13.11
AA seq 632 aa AA seqDB search
MAAAALRDPAQGCVTFEDVTIYFSQEEWVLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCHGTEGKDLPSEHNVSVEGVAQDR
SPEATLCPQKTCPCDICGLRLKDILHLAEHQTTHPRQKPFVCEAYVKGSEFSANLPRKQV
QQNVHNPIRTEEGQASPVKTCRDHTSDQLSTCREGGKDFVATAGFLQCEVTPSDGEPHEA
TEGVVDFHIALRHNKCCESGDAFNNKSTLVQHQRIHSRERPYECSKCGIFFTYAADLTQH
QKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVH
TGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGER
PYKCNECGKFFSHIASLIQHQIVHTGERPHGCGECGKAFSRSSDLMKHQRVHTGERPYEC
NECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLNNHRRLHTGERPYECSECG
KTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHIRERSMENVLLPCSQH
TPEISSENRPYQGAVNYKLKLVHPSTHPGEVP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcggcgctgcgggaccccgcgcagggctgcgtgacctttgaggacgtgacc
atttacttctcccaggaggagtgggtgctcctcgatgaggctcagagactcctgtactgc
gatgtgatgctggaaaactttgcacttatagcctcgctgggacttatatctttcaggtcc
cacatcgtttcccagttggagatggggaaagagccctgggtgcctgacagtgtggatatg
acatcagccatggccagaggggcttatggcaggcctggctctgatttttgccatggaaca
gagggcaaggacttaccttctgagcataacgtttctgtagaaggagtggcacaggacagg
agtcccgaggcaactctgtgcccccagaagacctgcccctgtgacatatgtggcctacgt
ttgaaagacattttgcatttggctgaacaccagacaacacatcccaggcagaaaccattt
gtgtgtgaggcatatgtgaaaggctctgagttcagtgcaaaccttccccggaaacaggtg
cagcagaacgtacacaaccctatcagaacggaggagggccaggcttcccctgtaaagacc
tgcagagaccacacatcagatcagctttccacctgcagggagggtgggaaggactttgtg
gccacagcagggtttctgcagtgtgaggtcactcccagcgatggggagccgcacgaggcc
accgaaggtgtggtggattttcacattgcactaaggcataacaagtgctgtgaatctggg
gatgccttcaataacaaatccactcttgttcagcaccagagaatccacagcagagaaagg
ccttatgaatgcagcaaatgtggaatcttcttcacttacgccgctgacctcactcaacac
cagaaagttcacaatagaggaaaaccgtatgagtgctgtgaatgtggaaaattcttcagc
cagcactccagccttgttaaacatcgcagggttcacaccggtgaaagccctcacgtgtgt
ggtgactgtgggaaattcttcagccgaagctccaacctcattcagcataagagggttcac
actggtgaaaagccatatgagtgcagcgactgtgggaagttcttcagccagcgttccaac
ctcattcatcataagagggttcatacgggcagaagtgcccatgagtgcagtgaatgtggg
aaatctttcaactgcaactccagcctaattaaacattggagagttcacactggagaaaga
ccttacaagtgtaacgaatgtgggaaattcttcagccacattgccagcctcattcaacat
cagatagttcacactggcgagcggcctcacgggtgtggtgagtgtgggaaagccttcagc
cgaagctctgacctcatgaaacatcagcgagttcacactggtgagcggccttatgaatgc
aatgaatgtgggaagttatttagccagagctccagcctcaatagccatcggagacttcac
actggtgaacggccttaccagtgcagtgaatgtgggaaattctttaaccaaagctccagc
ctcaataaccaccggagacttcacaccggcgagcggccttatgagtgcagcgaatgtggg
aaaaccttcaggcagaggtccaatctgaggcagcacctgaaagttcacaaaccagacagg
ccttacgaatgcagcgaatgtgggaaagccttcaaccaaaggcctaccctcattcggcat
cagaagattcacatcagagaaaggagcatggagaatgtgctccttccctgttcacagcac
acaccagagataagctctgagaacagaccttatcagggcgctgtcaactacaagttgaaa
cttgttcatccaagtacccaccctggggaggttccctag

DBGET integrated database retrieval system