KEGG   Homo sapiens (human): 1268
Entry
1268              CDS       T01001                                 

Gene name
CNR1, CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR
Definition
(RefSeq) cannabinoid receptor 1
  KO
K04277  cannabinoid receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
Drug target
Cannabidiol: D10915<US>
Dronabinol: D00306<US>
Ibipinabant: D09349
Levonantradol hydrochloride: D04717
Nabilone: D05099<US>
Nantradol hydrochloride: D05117
Nimacimab: D11435
Otenabant (DG01351): D09362 D09363
Rimonabant: D05731
Taranabant: D09009
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    1268 (CNR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1268 (CNR1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    1268 (CNR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1268 (CNR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1268 (CNR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Cannabinoid
    1268 (CNR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx YlaC
Other DBs
NCBI-GeneID: 1268
NCBI-ProteinID: NP_001153698
OMIM: 114610
HGNC: 2159
Ensembl: ENSG00000118432
Vega: OTTHUMG00000015184
Pharos: P21554(Tclin)
UniProt: P21554 S5TLS4
LinkDB
Structure
PDB: 
6N4B 2KOE

Position
6q15
AA seq 472 aa
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaagtcgatcctagatggccttgcagataccaccttccgcaccatcaccactgacctc
ctgtacgtgggctcaaatgacattcagtacgaagacatcaaaggtgacatggcatccaaa
ttagggtacttcccacagaaattccctttaacttcctttaggggaagtcccttccaagag
aagatgactgcgggagacaacccccagctagtcccagcagaccaggtgaacattacagaa
ttttacaacaagtctctctcgtccttcaaggagaatgaggagaacatccagtgtggggag
aacttcatggacatagagtgtttcatggtcctgaaccccagccagcagctggccattgca
gtcctgtccctcacgctgggcaccttcacggtcctggagaacctcctggtgctgtgcgtc
atcctccactcccgcagcctccgctgcaggccttcctaccacttcatcggcagcctggcg
gtggcagacctcctggggagtgtcatttttgtctacagcttcattgacttccacgtgttc
caccgcaaagatagccgcaacgtgtttctgttcaaactgggtggggtcacggcctccttc
actgcctccgtgggcagcctgttcctcacagccatcgacaggtacatatccattcacagg
cccctggcctataagaggattgtcaccaggcccaaggccgtggtggcgttttgcctgatg
tggaccatagccattgtgatcgccgtgctgcctctcctgggctggaactgcgagaaactg
caatctgtttgctcagacattttcccacacattgatgaaacctacctgatgttctggatc
ggggtcaccagcgtactgcttctgttcatcgtgtatgcgtacatgtatattctctggaag
gctcacagccacgccgtccgcatgattcagcgtggcacccagaagagcatcatcatccac
acgtctgaggatgggaaggtacaggtgacccggccagaccaagcccgcatggacattagg
ttagccaagaccctggtcctgatcctggtggtgttgatcatctgctggggccctctgctt
gcaatcatggtgtatgatgtctttgggaagatgaacaagctcattaagacggtgtttgca
ttctgcagtatgctctgcctgctgaactccaccgtgaaccccatcatctatgctctgagg
agtaaggacctgcgacacgctttccggagcatgtttccctcttgtgaaggcactgcgcag
cctctggataacagcatgggggactcggactgcctgcacaaacacgcaaacaatgcagcc
agtgttcacagggccgcagaaagctgcatcaagagcacggtcaagattgccaaggtaacc
atgtctgtgtccacagacacgtctgccgaggctctgtga

KEGG   Homo sapiens (human): 1269
Entry
1269              CDS       T01001                                 

Gene name
CNR2, CB-2, CB2, CX5
Definition
(RefSeq) cannabinoid receptor 2
  KO
K04278  cannabinoid receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Cannabidiol: D10915<US>
Dronabinol: D00306<US>
Lenabasum: D11312
Nabilone: D05099<US>
Olorinab: D11429
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1269 (CNR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1269 (CNR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Cannabinoid
    1269 (CNR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 1269
NCBI-ProteinID: NP_001832
OMIM: 605051
HGNC: 2160
Ensembl: ENSG00000188822
Vega: OTTHUMG00000013892
Pharos: P34972(Tchem)
UniProt: P34972 A0A024RAH7
LinkDB
Position
1p36.11
AA seq 360 aa
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaggaatgctgggtgacagagatagccaatggctccaaggatggcttggattccaac
cctatgaaggattacatgatcctgagtggtccccagaagacagctgttgctgtgttgtgc
actcttctgggcctgctaagtgccctggagaacgtggctgtgctctatctgatcctgtcc
tcccaccaactccgccggaagccctcatacctgttcattggcagcttggctggggctgac
ttcctggccagtgtggtctttgcatgcagctttgtgaatttccatgttttccatggtgtg
gattccaaggctgtcttcctgctgaagattggcagcgtgactatgaccttcacagcctct
gtgggtagcctcctgctgaccgccattgaccgatacctctgcctgcgctatccaccttcc
tacaaagctctgctcacccgtggaagggcactggtgaccctgggcatcatgtgggtcctc
tcagcactagtctcctacctgcccctcatgggatggacttgctgtcccaggccctgctct
gagcttttcccactgatccccaatgactacctgctgagctggctcctgttcatcgccttc
ctcttttccggaatcatctacacctatgggcatgttctctggaaggcccatcagcatgtg
gccagcttgtctggccaccaggacaggcaggtgccaggaatggcccgaatgaggctggat
gtgaggttggccaagaccctagggctagtgttggctgtgctcctcatctgttggttccca
gtgctggccctcatggcccacagcctggccactacgctcagtgaccaggtcaagaaggcc
tttgctttctgctccatgctgtgcctcatcaactccatggtcaaccctgtcatctatgct
ctacggagtggagagatccgctcctctgcccatcactgcctggctcactggaagaagtgt
gtgaggggccttgggtcagaggcaaaagaagaagccccgagatcctcagtcaccgagaca
gaggctgatgggaaaatcactccgtggccagattccagagatctagacctctctgattgc
tga

DBGET integrated database retrieval system