KEGG   Homo sapiens (human): 126961Help
Entry
126961            CDS       T01001                                 

Gene name
HIST2H3C, H3, H3.2, H3/M, H3F2, H3FM, H3FN
Definition
(RefSeq) histone cluster 2 H3 family member c
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    126961 (HIST2H3C)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    126961 (HIST2H3C)
  09165 Substance dependence
   05034 Alcoholism
    126961 (HIST2H3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    126961 (HIST2H3C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    126961 (HIST2H3C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    126961 (HIST2H3C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126961 (HIST2H3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 126961
NCBI-ProteinID: NP_066403
OMIM: 142780
HGNC: 20503
Ensembl: ENSG00000203811
Vega: OTTHUMG00000012190
UniProt: Q71DI3
LinkDB All DBs
Structure
PDB: 

Position
1q21.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagactgctcgcaagtcgaccggcggcaaggccccgaggaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtagccctgcgggagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatt
atgcccaaggacatccagctggcccgccgcatccgtggagagcgggcttaa

KEGG   Homo sapiens (human): 3020Help
Entry
3020              CDS       T01001                                 

Gene name
H3F3A, H3.3A, H3F3
Definition
(RefSeq) H3 histone family member 3A
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Disease
H01470  Giant cell tumor of bone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3020 (H3F3A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3020 (H3F3A)
  09165 Substance dependence
   05034 Alcoholism
    3020 (H3F3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3020 (H3F3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3020 (H3F3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3020 (H3F3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3020 (H3F3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3020
NCBI-ProteinID: NP_002098
OMIM: 601128
HGNC: 4764
Ensembl: ENSG00000163041
Vega: OTTHUMG00000037507
UniProt: P84243 B2R4P9
LinkDB All DBs
Structure
PDB: 

Position
1q42.12
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtggcgctccgtgaaattagacgttatcagaagtccactgaa
cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa
acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

KEGG   Homo sapiens (human): 3021Help
Entry
3021              CDS       T01001                                 

Gene name
H3F3B, H3.3B
Definition
(RefSeq) H3 histone family member 3B
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3021 (H3F3B)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3021 (H3F3B)
  09165 Substance dependence
   05034 Alcoholism
    3021 (H3F3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3021 (H3F3B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3021 (H3F3B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3021 (H3F3B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3021 (H3F3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3021
NCBI-ProteinID: NP_005315
OMIM: 601058
HGNC: 4765
Ensembl: ENSG00000132475
Vega: OTTHUMG00000179842
Pharos: P84243(Tbio)
UniProt: P84243 B2R4P9
LinkDB All DBs
Structure
PDB: 

Position
17q25.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgctcgtaagtccaccggtgggaaagccccccgcaaacag
ctggccacgaaagccgccaggaaaagcgctccctctaccggcggggtgaagaagcctcat
cgctacaggcccgggaccgtggcgcttcgagagattcgtcgttatcagaagtcgaccgag
ctgctcatccggaagctgcccttccagaggttggtgagggagatcgcgcaggatttcaaa
accgacctgaggtttcagagcgcagccatcggtgcgctgcaggaggctagcgaagcgtac
ctggtgggtctgttcgaagataccaacctgtgtgccatccacgctaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

KEGG   Homo sapiens (human): 333932Help
Entry
333932            CDS       T01001                                 

Gene name
HIST2H3A, H3/n, H3/o
Definition
(RefSeq) histone cluster 2 H3 family member a
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    333932 (HIST2H3A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    333932 (HIST2H3A)
  09165 Substance dependence
   05034 Alcoholism
    333932 (HIST2H3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    333932 (HIST2H3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    333932 (HIST2H3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    333932 (HIST2H3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   333932 (HIST2H3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 333932
NCBI-ProteinID: NP_001005464
HGNC: 20505
Ensembl: ENSG00000203852
Vega: OTTHUMG00000012094
UniProt: Q71DI3
LinkDB All DBs
Structure
PDB: 

Position
1q21.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagactgctcgcaagtcgaccggcggcaaggccccgaggaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtagccctgcgggagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatt
atgcccaaggacatccagctggcccgccgcatccgtggagagcgggcttaa

KEGG   Homo sapiens (human): 440093Help
Entry
440093            CDS       T01001                                 

Gene name
H3F3C, H3.5
Definition
(RefSeq) H3 histone family member 3C
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    440093 (H3F3C)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    440093 (H3F3C)
  09165 Substance dependence
   05034 Alcoholism
    440093 (H3F3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    440093 (H3F3C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    440093 (H3F3C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    440093 (H3F3C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   440093 (H3F3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 440093
NCBI-ProteinID: NP_001013721
OMIM: 616134
HGNC: 33164
Ensembl: ENSG00000188375
Vega: OTTHUMG00000157811
Pharos: Q6NXT2(Tbio)
UniProt: Q6NXT2
LinkDB All DBs
Structure
PDB: 

Position
12p11.21
AA seq 135 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgctcgtaaatccaccggtgggaaagccccccgcaaacag
ctggccacgaaagctgccaggaaaagcaccccctctacctgcggggtgaagcctcatcgc
tacaggcctgggaccgtggcgcttcgagagattcgtcgttatcagaagtcgaccgagctg
ctcatccggaagctgcccttccagaggttggtgagggagatcgcgcaggatttcaacact
gacctgaggtttcagagcgcagccgtcggtgcgctgcaggaggctagcgaagcgtacctg
gtgggtctgttggaagatactaacctgtgtgccatccacgctaagagagtcaccatcatg
cccaaagacatccagttggctcgccggatacggggagagagagcttaa

KEGG   Homo sapiens (human): 653604Help
Entry
653604            CDS       T01001                                 

Gene name
HIST2H3D
Definition
(RefSeq) histone cluster 2 H3 family member d
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    653604 (HIST2H3D)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    653604 (HIST2H3D)
  09165 Substance dependence
   05034 Alcoholism
    653604 (HIST2H3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    653604 (HIST2H3D)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    653604 (HIST2H3D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    653604 (HIST2H3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   653604 (HIST2H3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 653604
NCBI-ProteinID: NP_001116847
HGNC: 25311
Ensembl: ENSG00000183598
Vega: OTTHUMG00000012092
Pharos: Q71DI3(Tdark)
UniProt: Q71DI3
LinkDB All DBs
Structure
PDB: 

Position
1q21.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaagcagactgcccgcaagtcgaccggcggcaaggccccgaggaagcag
ctggctaccaaagcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtggctctgcgggagatccggcgctaccagaagtctacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccatgccaagcgcgtgaccatc
atgcccaaggacatccagttggcccgccgcatccgcggggagcgggcctaa

KEGG   Homo sapiens (human): 8290Help
Entry
8290              CDS       T01001                                 

Gene name
HIST3H3, H3.4, H3/g, H3FT, H3t
Definition
(RefSeq) histone cluster 3 H3
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8290 (HIST3H3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8290 (HIST3H3)
  09165 Substance dependence
   05034 Alcoholism
    8290 (HIST3H3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8290 (HIST3H3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8290 (HIST3H3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8290 (HIST3H3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8290 (HIST3H3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone PAF CBFD_NFYB_HMF CENP-S CENP-T_C
Motif
Other DBs
NCBI-GeneID: 8290
NCBI-ProteinID: NP_003484
OMIM: 602820
HGNC: 4778
Ensembl: ENSG00000168148
Vega: OTTHUMG00000040044
Pharos: Q16695(Tbio)
UniProt: Q16695
LinkDB All DBs
Structure
PDB: 

Position
1q42.13
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgcgcgcaagtcaacgggtggcaaggcgccgcgcaagcag
ctggccaccaaggtggctcgcaagagcgcacctgccactggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgcttcgcgagatccgccgctaccagaagtccactgag
ctgctaatccgcaagttgcccttccagcggctgatgcgcgagatcgctcaggactttaag
accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgagtcttac
ctggtggggctgtttgaggacaccaacctgtgtgtcatccatgccaaacgggtcaccatc
atgcctaaggacatccagctggcacgccgtatccgcggggagcgggcctag

KEGG   Homo sapiens (human): 8350Help
Entry
8350              CDS       T01001                                 

Gene name
HIST1H3A, H3/A, H3FA
Definition
(RefSeq) histone cluster 1 H3 family member a
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8350 (HIST1H3A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8350 (HIST1H3A)
  09165 Substance dependence
   05034 Alcoholism
    8350 (HIST1H3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8350 (HIST1H3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8350 (HIST1H3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8350 (HIST1H3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8350 (HIST1H3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8350
NCBI-ProteinID: NP_003520
OMIM: 602810
HGNC: 4766
Ensembl: ENSG00000275714
Vega: OTTHUMG00000014418
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcactaagcaaactgctcggaagtctactggtggcaaggcgccacgcaaacag
ttggccactaaggcagcccgcaaaagcgctccggccaccggcggcgtgaaaaagccccac
cgctaccggccgggcaccgtggctctgcgcgagatccgccgttatcagaagtccactgaa
ctgcttattcgtaaactacctttccagcgcctggtgcgcgagattgcgcaggactttaaa
acagacctgcgtttccagagctccgctgtgatggctctgcaggaggcgtgcgaggcctac
ttggtagggctatttgaggacactaacctgtgcgccatccacgccaagcgcgtcactatc
atgcccaaggacatccagctcgcccgccgcatccgcggagagagggcgtga

KEGG   Homo sapiens (human): 8351Help
Entry
8351              CDS       T01001                                 

Gene name
HIST1H3D, H3/b, H3FB
Definition
(RefSeq) histone cluster 1 H3 family member d
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8351 (HIST1H3D)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8351 (HIST1H3D)
  09165 Substance dependence
   05034 Alcoholism
    8351 (HIST1H3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8351 (HIST1H3D)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8351 (HIST1H3D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8351 (HIST1H3D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8351 (HIST1H3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8351
NCBI-ProteinID: NP_003521
OMIM: 602811
HGNC: 4767
Ensembl: ENSG00000197409
Vega: OTTHUMG00000014433
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcagactgctcgcaagtccacgggtgggaaagcgccacgcaagcag
ctggccaccaaggctgctcgaaagagcgctccagccaccggcggcgtgaagaagccccac
cgttaccggcccggcacggtggctctgcgcgagatccgccgctaccagaagtcgaccgag
ctgctgattcgcaaactgccattccagcgtctagtccgtgagatcgcgcaggacttcaag
actgatctgcgttttcagagctcggcggtgatggcgctgcaggaggcctgcgaggcctac
ctggtggggctgtttgaggacaccaacctatgcgccattcacgccaagcgagtgactatc
atgcccaaggacatccagcttgctcgccgcattcgtggggagagggcgtaa

KEGG   Homo sapiens (human): 8352Help
Entry
8352              CDS       T01001                                 

Gene name
HIST1H3C, H3.1, H3/c, H3FC
Definition
(RefSeq) histone cluster 1 H3 family member c
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8352 (HIST1H3C)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8352 (HIST1H3C)
  09165 Substance dependence
   05034 Alcoholism
    8352 (HIST1H3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8352 (HIST1H3C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8352 (HIST1H3C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8352 (HIST1H3C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8352 (HIST1H3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8352
NCBI-ProteinID: NP_003522
OMIM: 602812
HGNC: 4768
Ensembl: ENSG00000287080
Vega: OTTHUMG00000014416
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacgaagcaaacagctcgcaagtctaccggcggcaaagctccgcgcaagcag
cttgctactaaagcagcccgtaagagcgctccggccaccggtggcgtgaagaaacctcat
cgctaccgcccgggcaccgtggccttgcgcgaaatccgtcgctaccagaagtccaccgag
ctgctgatccggaagctgccgttccagcgcctggtgcgagaaatcgcccaggacttcaaa
accgacctgcgtttccagagctctgcggtgatggcgctgcaggaggcttgtgaggcctac
ctggtgggactcttcgaagacaccaatctgtgcgctattcacgctaaacgcgtcaccatc
atgcccaaagatatccagctggcacgtcgcatccgtggggaaagggcataa

KEGG   Homo sapiens (human): 8353Help
Entry
8353              CDS       T01001                                 

Gene name
HIST1H3E, H3.1, H3/d, H3FD
Definition
(RefSeq) histone cluster 1 H3 family member e
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8353 (HIST1H3E)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8353 (HIST1H3E)
  09165 Substance dependence
   05034 Alcoholism
    8353 (HIST1H3E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8353 (HIST1H3E)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8353 (HIST1H3E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8353 (HIST1H3E)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8353 (HIST1H3E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8353
NCBI-ProteinID: NP_003523
OMIM: 602813
HGNC: 4769
Ensembl: ENSG00000274750
Vega: OTTHUMG00000014434
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtactaagcagacggctcgtaaatccacaggcggtaaagcaccgcgcaaacag
ctggccactaaggcagctcgcaagagcgctccggccacgggcggcgtgaagaagccccat
cgctaccgccctggcaccgtggctctgcgcgagatccgtcgctaccagaagtctaccgag
cttctaatccggaagctgccgtttcagcgcctggtgcgagaaatagctcaggacttcaag
accgacctgcgcttccagagttccgcggtgatggcgctgcaggaggcctgcgaggcctac
ttggtggggcttttcgaggacaccaacctgtgcgctattcatgccaaacgcgtgaccatc
atgcctaaagacatccagcttgcccgccgcattcgtggggagagggcgtga

KEGG   Homo sapiens (human): 8354Help
Entry
8354              CDS       T01001                                 

Gene name
HIST1H3I, H3.f, H3/f, H3FF
Definition
(RefSeq) histone cluster 1 H3 family member i
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8354 (HIST1H3I)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8354 (HIST1H3I)
  09165 Substance dependence
   05034 Alcoholism
    8354 (HIST1H3I)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8354 (HIST1H3I)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8354 (HIST1H3I)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8354 (HIST1H3I)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8354 (HIST1H3I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8354
NCBI-ProteinID: NP_003524
OMIM: 602814
HGNC: 4771
Ensembl: ENSG00000275379
Vega: OTTHUMG00000016184
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaacaaagcaaacagctcgcaagtccaccggcggcaaagcgccgcgcaagcag
ctggccaccaaggcggctcgcaagagcgctccggccaccggtggcgtcaagaagccccac
cgctaccgccccggcaccgtggccctgcgcgagatccgccgctaccagaagtcgaccgag
ctgctaatccggaagctaccttttcagcgcttggtacgggagatcgcacaggactttaag
accgatctgcgcttccagagctcggcggtgatggcgctgcaggaggcttgcgaggcctac
ctggtggggctatttgaggataccaacctgtgcgccattcacgccaaacgcgtcactatt
atgcctaaagacatccagcttgcgcgccgcatccgaggggagagggcataa

KEGG   Homo sapiens (human): 8355Help
Entry
8355              CDS       T01001                                 

Gene name
HIST1H3G, H3/h, H3FH
Definition
(RefSeq) histone cluster 1 H3 family member g
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8355 (HIST1H3G)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8355 (HIST1H3G)
  09165 Substance dependence
   05034 Alcoholism
    8355 (HIST1H3G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8355 (HIST1H3G)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8355 (HIST1H3G)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8355 (HIST1H3G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8355 (HIST1H3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8355
NCBI-ProteinID: NP_003525
OMIM: 602815
HGNC: 4772
Ensembl: ENSG00000273983
Vega: OTTHUMG00000014436
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaccaagcagactgcacgcaagtccaccggtggcaaagcgccgcgcaagcag
ctggccactaaggcggctcggaaaagcgcgccggccaccggcggcgtgaagaaacctcat
cgctaccgtcccggcaccgtggctctgcgcgagattcgccgctatcagaagtcgactgag
ctgctgatccgcaagttgcctttccaacgcctggtgcgagaaatcgctcaggacttcaag
acagatctgcgctttcagagttccgcggtgatggccctgcaggaggcctgcgaggcctac
ttggtggggctctttgaggataccaacctgtgtgccatccatgctaagcgagtgactatc
atgcccaaggacattcagctcgctcgccgcattcgtggggagagagcgtag

KEGG   Homo sapiens (human): 8356Help
Entry
8356              CDS       T01001                                 

Gene name
HIST1H3J, H3/j, H3FJ
Definition
(RefSeq) histone cluster 1 H3 family member j
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8356 (HIST1H3J)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8356 (HIST1H3J)
  09165 Substance dependence
   05034 Alcoholism
    8356 (HIST1H3J)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8356 (HIST1H3J)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8356 (HIST1H3J)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8356 (HIST1H3J)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8356 (HIST1H3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8356
NCBI-ProteinID: NP_003526
OMIM: 602817
HGNC: 4774
Ensembl: ENSG00000197153
Vega: OTTHUMG00000016185
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccggacgaagcagacagctcgcaagtctaccggcggcaaggcaccgcggaagcag
ctggccaccaaggcagcgcgcaaaagcgctccagcgactggcggtgtgaagaagccccac
cgctacaggccaggcaccgtggccttgcgtgagatccgccgttatcagaagtcgactgag
ctgctcatccgcaaactgccatttcagcgcctggtgcgagaaatcgcgcaggatttcaaa
accgaccttcgtttccagagctcggcggtgatggcgctgcaagaggcgtgcgaggcctat
ctggtgggtctctttgaagacaccaacctctgtgctattcacgccaagcgtgtcactatt
atgcctaaggacatccagcttgcgcgtcgtatccgtggcgagcgagcataa

KEGG   Homo sapiens (human): 8357Help
Entry
8357              CDS       T01001                                 

Gene name
HIST1H3H, H3/k, H3F1K, H3FK
Definition
(RefSeq) histone cluster 1 H3 family member h
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8357 (HIST1H3H)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8357 (HIST1H3H)
  09165 Substance dependence
   05034 Alcoholism
    8357 (HIST1H3H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8357 (HIST1H3H)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8357 (HIST1H3H)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8357 (HIST1H3H)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8357 (HIST1H3H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8357
NCBI-ProteinID: NP_003527
OMIM: 602818
HGNC: 4775
Ensembl: ENSG00000278828
Vega: OTTHUMG00000014483
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtacgaagcagactgctcgcaagtccaccggcggcaaggctccgcgcaagcag
ctggccaccaaggcggctcggaagagcgctccggccaccggcggtgtcaagaagccccat
cgctatcggcctggtacagtggctctccgcgagattcgccgctaccagaagtccaccgag
ctgctgatcagaaagctgccttttcagcgtctggtgcgtgagatcgcgcaggacttcaag
accgacttgcgcttccagagctccgcggtgatggcgctgcaagaggcatgcgaggcctac
ctggtggggctctttgaggacaccaacctgtgcgccatccacgccaagcgggtgactatc
atgcccaaggacatccagctcgcacgtcgtatccgcggcgagagggcttga

KEGG   Homo sapiens (human): 8358Help
Entry
8358              CDS       T01001                                 

Gene name
HIST1H3B, H3/l, H3FL
Definition
(RefSeq) histone cluster 1 H3 family member b
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8358 (HIST1H3B)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8358 (HIST1H3B)
  09165 Substance dependence
   05034 Alcoholism
    8358 (HIST1H3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8358 (HIST1H3B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8358 (HIST1H3B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8358 (HIST1H3B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8358 (HIST1H3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8358
NCBI-ProteinID: NP_003528
OMIM: 602819
HGNC: 4776
Ensembl: ENSG00000286522
Vega: OTTHUMG00000014415
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtactaaacagacagctcggaaatccaccggcggtaaagcgccacgcaagcag
ctggctaccaaggctgctcgcaagagcgcgccggctaccggcggcgtgaaaaagcctcac
cgttaccgcccgggcactgtggctctgcgcgagatccgccgctaccaaaagtcgaccgag
ttgctgattcggaagctgccgttccagcgcctggtgcgagaaatcgcccaagacttcaag
accgatcttcgcttccagagctctgcggtgatggcgctgcaggaggcttgtgaggcctac
ttggtagggctctttgaggacacaaacctttgcgccatccatgctaagcgagtgactatt
atgcccaaagacatccagctcgctcgccgcattcgcggagaaagagcgtaa

KEGG   Homo sapiens (human): 8968Help
Entry
8968              CDS       T01001                                 

Gene name
HIST1H3F, H3/i, H3FI
Definition
(RefSeq) histone cluster 1 H3 family member f
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8968 (HIST1H3F)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8968 (HIST1H3F)
  09165 Substance dependence
   05034 Alcoholism
    8968 (HIST1H3F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8968 (HIST1H3F)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8968 (HIST1H3F)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8968 (HIST1H3F)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8968 (HIST1H3F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8968
NCBI-ProteinID: NP_066298
OMIM: 602816
HGNC: 4773
Ensembl: ENSG00000277775
Vega: OTTHUMG00000014435
Pharos: P68431(Tbio)
UniProt: P68431
LinkDB All DBs
Structure
PDB: 

Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcacgaagcaaacagctcgtaagtccactggcggcaaagccccgcgcaagcag
ctggccactaaggcggctcgcaaaagcgcgccagccaccggtggcgtgaagaagccccac
cgctacaggcctggtactgtcgccctccgtgaaatccgccgctatcagaaatcgactgag
ctactgattcgcaagctaccattccagcgtctggtacgtgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggctgtgatggcgctgcaggaggcctgcgaggcttac
ctggtggggctctttgaggacaccaacctgtgtgctatccacgccaagcgagtgactatc
atgcccaaggacatccagctcgctcgccgcattcgcggagagagggcataa

DBGET integrated database retrieval system