KEGG   Homo sapiens (human): 1270
Entry
1270              CDS       T01001                                 

Gene name
CNTF, HCNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1270 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1270 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1270 (CNTF)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1270 (CNTF)
SSDB
Motif
Pfam: CNTF
Other DBs
NCBI-GeneID: 1270
NCBI-ProteinID: NP_000605
OMIM: 118945
HGNC: 2169
Ensembl: ENSG00000242689
Vega: OTTHUMG00000137476
Pharos: P26441(Tbio)
UniProt: P26441
LinkDB
Structure
PDB: 
1CNT

Position
11q12.1
AA seq 200 aa
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA
YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS
SHQTGIPARGSHYIANNKKM
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctttcacagagcattcaccgctgacccctcaccgtcgggacctctgtagccgctct
atctggctagcaaggaagattcgttcagacctgactgctcttacggaatcctatgtgaag
catcagggcctgaacaagaacatcaacctggactctgcggatgggatgccagtggcaagc
actgatcagtggagtgagctgaccgaggcagagcgactccaagagaaccttcaagcttat
cgtaccttccatgttttgttggccaggctcttagaagaccagcaggtgcattttacccca
accgaaggtgacttccatcaagctatacatacccttcttctccaagtcgctgcctttgca
taccagatagaggagttaatgatactcctggaatacaagatcccccgcaatgaggctgat
gggatgcctattaatgttggagatggtggtctctttgagaagaagctgtggggcctaaag
gtgctgcaggagctttcacagtggacagtaaggtccatccatgaccttcgtttcatttct
tctcatcagactgggatcccagcacgtgggagccattatattgctaacaacaagaaaatg
tag

KEGG   Homo sapiens (human): 1440
Entry
1440              CDS       T01001                                 

Gene name
CSF3, C17orf33, CSF3OS, GCSF, G-CSF
Definition
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1440 (CSF3)
   04151 PI3K-Akt signaling pathway
    1440 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1440 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1440 (CSF3)
   04657 IL-17 signaling pathway
    1440 (CSF3)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    1440 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1440 (CSF3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1440 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 NAGLU Img2
Other DBs
NCBI-GeneID: 1440
NCBI-ProteinID: NP_000750
OMIM: 138970
HGNC: 2438
Ensembl: ENSG00000108342
Vega: OTTHUMG00000133247
Pharos: P09919(Tbio)
UniProt: P09919 Q8N4W3
LinkDB
Structure
PDB: 

Position
17q21.1
AA seq 207 aa
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP
NT seq 624 nt   +upstreamnt  +downstreamnt
atggctggacctgccacccagagccccatgaagctgatggccctgcagctgctgctgtgg
cacagtgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcagcg
ctccaggagaagctggtgagtgagtgtgccacctacaagctgtgccaccccgaggagctg
gtgctgctcggacactctctgggcatcccctgggctcccctgagcagctgccccagccag
gccctgcagctggcaggctgcttgagccaactccatagcggccttttcctctaccagggg
ctcctgcaggccctggaagggatctcccccgagttgggtcccaccttggacacactgcag
ctggacgtcgccgactttgccaccaccatctggcagcagatggaagaactgggaatggcc
cctgccctgcagcccacccagggtgccatgccggccttcgcctctgctttccagcgccgg
gcaggaggggtcctggttgcctcccatctgcagagcttcctggaggtgtcgtaccgcgtt
ctacgccaccttgcccagccctga

KEGG   Homo sapiens (human): 1442
Entry
1442              CDS       T01001                                 

Gene name
CSH1, CS-1, CSA, CSMT, GHB3, PL, hCS-1, hCS-A
Definition
(RefSeq) chorionic somatomammotropin hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1442 (CSH1)
   04151 PI3K-Akt signaling pathway
    1442 (CSH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1442 (CSH1)
   04060 Cytokine-cytokine receptor interaction
    1442 (CSH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1442 (CSH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1442 (CSH1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1442 (CSH1)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 1442
NCBI-ProteinID: NP_001308
OMIM: 150200
HGNC: 2440
Ensembl: ENSG00000136488
Vega: OTTHUMG00000171947
Pharos: P0DML2(Tbio)
CPD: C18210
UniProt: P0DML2 P0DML3 A8K6C2
LinkDB
Structure
PDB: 
1Z7C

Position
17q23.3
AA seq 217 aa
MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctccaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcgcacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 1443
Entry
1443              CDS       T01001                                 

Gene name
CSH2, CS-2, CSB, GHB1, PL, hCS-B
Definition
(RefSeq) chorionic somatomammotropin hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1443 (CSH2)
   04151 PI3K-Akt signaling pathway
    1443 (CSH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1443 (CSH2)
   04060 Cytokine-cytokine receptor interaction
    1443 (CSH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1443 (CSH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1443 (CSH2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1443 (CSH2)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 1443
NCBI-ProteinID: NP_066271
OMIM: 118820
HGNC: 2441
Ensembl: ENSG00000213218
Vega: OTTHUMG00000172283
Pharos: P0DML3(Tbio)
UniProt: P0DML3 A0A0M6L0F6
LinkDB
Structure
PDB: 
1Z7C

Position
17q23.3
AA seq 217 aa
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttccgttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcacacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtagagggtagctgtggcttctag

KEGG   Homo sapiens (human): 2056
Entry
2056              CDS       T01001                                 

Gene name
EPO, DBAL, ECYT5, EP, MVCD2
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01360  Allergic rhinitis
H01457  Diabetic retinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2056 (EPO)
   04066 HIF-1 signaling pathway
    2056 (EPO)
   04151 PI3K-Akt signaling pathway
    2056 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2056 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2056 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2056 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2056 (EPO)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2056 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 2056
NCBI-ProteinID: NP_000790
OMIM: 133170
HGNC: 3415
Ensembl: ENSG00000130427
Vega: OTTHUMG00000152121
Pharos: P01588(Tbio)
CPD: C18200
UniProt: P01588 G9JKG7
LinkDB
Structure
PDB: 
1EER 1CN4 1BUY

Position
7q22.1
AA seq 193 aa
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatatcacgacgggctgtgctgaacactgc
agcttgaatgagaatatcactgtcccagacaccaaagttaatttctatgcctggaagagg
atggaggtcgggcagcaggccgtagaagtctggcagggcctggccctgctgtcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
catgtggataaagccgtcagtggccttcgcagcctcaccactctgcttcgggctctggga
gcccagaaggaagccatctcccctccagatgcggcctcagctgctccactccgaacaatc
actgctgacactttccgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacaggggaggcctgcaggacaggggacagatga

KEGG   Homo sapiens (human): 2688
Entry
2688              CDS       T01001                                 

Gene name
GH1, GH, GH-N, GHB5, GHN, IGHD1A, IGHD1B, IGHD2, hGH-N
Definition
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N00908  Mutation-inactivated GH to GH-Jak-STAT signaling pathway
N00909  Mutation-inactivated GHR to GH-Jak-STAT signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
Disease
H00254  Growth hormone deficiency
H02035  Isolated growth hormone deficiency
H02039  Kowarski syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2688 (GH1)
   04151 PI3K-Akt signaling pathway
    2688 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2688 (GH1)
   04060 Cytokine-cytokine receptor interaction
    2688 (GH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2688 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2688 (GH1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2688 (GH1)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 2688
NCBI-ProteinID: NP_000506
OMIM: 139250
HGNC: 4261
Ensembl: ENSG00000259384
Vega: OTTHUMG00000172293
Pharos: P01241(Tbio)
CPD: C18181
UniProt: P01241 B1A4G6
LinkDB
Structure
PDB: 

Position
17q23.3
AA seq 217 aa
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctacaggctcccggacgtccctgctcctggcttttggcctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccatcgtctgcaccagctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgtttc
tcagagtctattccgacaccctccaacagggaggaaacacaacagaaatccaacctagag
ctgctccgcatctccctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtcttcgccaacagcctggtgtacggcgcctctgacagcaacgtctatgacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagatggcagcccccgg
actgggcagatcttcaagcagacctacagcaagttcgacacaaactcacacaacgatgac
gcactactcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 2689
Entry
2689              CDS       T01001                                 

Gene name
GH2, GH-V, GHB2, GHL, GHV, hGH-V
Definition
(RefSeq) growth hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N00909  Mutation-inactivated GHR to GH-Jak-STAT signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2689 (GH2)
   04151 PI3K-Akt signaling pathway
    2689 (GH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2689 (GH2)
   04060 Cytokine-cytokine receptor interaction
    2689 (GH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2689 (GH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2689 (GH2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2689 (GH2)
SSDB
Motif
Pfam: Hormone_1 DUF594
Other DBs
NCBI-GeneID: 2689
NCBI-ProteinID: NP_002050
OMIM: 139240
HGNC: 4262
Ensembl: ENSG00000136487
Vega: OTTHUMG00000172284
Pharos: P01242(Tbio)
UniProt: P01242 A0A0M6L0J9
LinkDB
Position
17q23.3
AA seq 217 aa
MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttggcctgctctgcctgtcctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccgtcgcctgtaccagctggcatatgacacctatcaggagtttgaagaagcc
tatatcctgaaggagcagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccaacaccttccaacagggtgaaaacgcagcagaaatctaacctagag
ctgctccgcatctccctgctgctcatccagtcatggctggagcccgtgcagctcctcagg
agcgtcttcgccaacagcctggtgtatggcgcctcggacagcaacgtctatcgccacctg
aaggacctagaggaaggcatccaaacgctgatgtggaggctggaagatggcagcccccgg
actgggcagatcttcaatcagtcctacagcaagtttgacacaaaatcgcacaacgatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 3952
Entry
3952              CDS       T01001                                 

Gene name
LEP, LEPD, OB, OBS
Definition
(RefSeq) leptin
  KO
K05424  leptin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04152  AMPK signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease
Disease
H02059  Leptin deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3952 (LEP)
   04152 AMPK signaling pathway
    3952 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3952 (LEP)
   04060 Cytokine-cytokine receptor interaction
    3952 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    3952 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    3952 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3952 (LEP)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   3952 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 3952
NCBI-ProteinID: NP_000221
OMIM: 164160
HGNC: 6553
Ensembl: ENSG00000174697
Vega: OTTHUMG00000157564
Pharos: P41159(Tbio)
CPD: C18188
UniProt: P41159 A4D0Y8
LinkDB
Structure
PDB: 
1AX8

Position
7q32.1
AA seq 167 aa
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcattggggaaccctgtgcggattcttgtggctttggccctatcttttctatgtccaa
gctgtgcccatccaaaaagtccaagatgacaccaaaaccctcatcaagacaattgtcacc
aggatcaatgacatttcacacacgcagtcagtctcctccaaacagaaagtcaccggtttg
gacttcattcctgggctccaccccatcctgaccttatccaagatggaccagacactggca
gtctaccaacagatcctcaccagtatgccttccagaaacgtgatccaaatatccaacgac
ctggagaacctccgggatcttcttcacgtgctggccttctctaagagctgccacttgccc
tgggccagtggcctggagaccttggacagcctggggggtgtcctggaagcttcaggctac
tccacagaggtggtggccctgagcaggctgcaggggtctctgcaggacatgctgtggcag
ctggacctcagccctgggtgctga

KEGG   Homo sapiens (human): 5617
Entry
5617              CDS       T01001                                 

Gene name
PRL, GHA1
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Network
nt06325  PRL signaling
  Element
N00920  PRL-JAK-STAT signaling pathway
N00921  Mutation-inactivated PRLR to PRL-JAK-STAT signaling pathway
Drug target
Bromocriptine (DG00452): D00780<JP/US> D03165
Cabergoline: D00987<JP/US>
Terguride: D01348
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    5617 (PRL)
   04151 PI3K-Akt signaling pathway
    5617 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5617 (PRL)
   04060 Cytokine-cytokine receptor interaction
    5617 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    5617 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5617 (PRL)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   5617 (PRL)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 5617
NCBI-ProteinID: NP_000939
OMIM: 176760
HGNC: 9445
Ensembl: ENSG00000172179
Vega: OTTHUMG00000016111
Pharos: P01236(Tbio)
CPD: C18201
UniProt: P01236 Q5THQ0
LinkDB
Structure
PDB: 

Position
6p22.3
AA seq 227 aa
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG
LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaacatcaaaggatcgccatggaaagggtccctcctgctgctgctggtgtcaaacctg
ctcctgtgccagagcgtggcccccttgcccatctgtcccggcggggctgcccgatgccag
gtgacccttcgagacctgtttgaccgcgccgtcgtcctgtcccactacatccataacctc
tcctcagaaatgttcagcgaattcgataaacggtatacccatggccgggggttcattacc
aaggccatcaacagctgccacacttcttcccttgccacccccgaagacaaggagcaagcc
caacagatgaatcaaaaagactttctgagcctgatagtcagcatattgcgatcctggaat
gagcctctgtatcatctggtcacggaagtacgtggtatgcaagaagccccggaggctatc
ctatccaaagctgtagagattgaggagcaaaccaaacggcttctagagggcatggagctg
atagtcagccaggttcatcctgaaaccaaagaaaatgagatctaccctgtctggtcggga
cttccatccctgcagatggctgatgaagagtctcgcctttctgcttattataacctgctc
cactgcctacgcagggattcacataaaatcgacaattatctcaagctcctgaagtgccga
atcatccacaacaacaactgctaa

KEGG   Homo sapiens (human): 7066
Entry
7066              CDS       T01001                                 

Gene name
THPO, MGDF, MKCSF, ML, MPLLG, THCYT1, TPO
Definition
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    7066 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7066 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    7066 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7066 (THPO)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   7066 (THPO)
SSDB
Motif
Pfam: EPO_TPO CYTL1
Other DBs
NCBI-GeneID: 7066
NCBI-ProteinID: NP_000451
OMIM: 600044
HGNC: 11795
Ensembl: ENSG00000090534
Vega: OTTHUMG00000156745
Pharos: P40225(Tbio)
UniProt: P40225
LinkDB
Structure
PDB: 
1V7M 1V7N

Position
3q27.1
AA seq 353 aa
MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPV
LLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRL
LLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTT
AVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSL
DQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP
TGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagctgactgaattgctcctcgtggtcatgcttctcctaactgcaaggctaacgctg
tccagcccggctcctcctgcttgtgacctccgagtcctcagtaaactgcttcgtgactcc
catgtccttcacagcagactgagccagtgcccagaggttcaccctttgcctacacctgtc
ctgctgcctgctgtggactttagcttgggagaatggaaaacccagatggaggagaccaag
gcacaggacattctgggagcagtgacccttctgctggagggagtgatggcagcacgggga
caactgggacccacttgcctctcatccctcctggggcagctttctggacaggtccgtctc
ctccttggggccctgcagagcctccttggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccaatgccatcttcctgagcttccaacacctgctccgaggaaaggtg
cgtttcctgatgcttgtaggagggtccaccctctgcgtcaggcgggccccacccaccaca
gctgtccccagcagaacctctctagtcctcacactgaacgagctcccaaacaggacttct
ggattgttggagacaaacttcactgcctcagccagaactactggctctgggcttctgaag
tggcagcagggattcagagccaagattcctggtctgctgaaccaaacctccaggtccctg
gaccaaatccccggatacctgaacaggatacacgaactcttgaatggaactcgtggactc
tttcctggaccctcacgcaggaccctaggagccccggacatttcctcaggaacatcagac
acaggctccctgccacccaacctccagcctggatattctccttccccaacccatcctcct
actggacagtatacgctcttccctcttccacccaccttgcccacccctgtggtccagctc
caccccctgcttcctgacccttctgctccaacgcccacccctaccagccctcttctaaac
acatcctacacccactcccagaatctgtctcaggaagggtaa

DBGET integrated database retrieval system