KEGG   Homo sapiens (human): 1286Help
Entry
1286              CDS       T01001                                 

Gene name
COL4A4, ATS2, BFH, CA44
Definition
(RefSeq) collagen type IV alpha 4 chain
  KO
K06237  collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04974  Protein digestion and absorption
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Disease
H00581  Alport syndrome
H00582  Benign familial hematuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    1286 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    1286 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1286 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    1286 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    1286 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1286 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    1286 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    1286 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1286 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    1286 (COL4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1286 (COL4A4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1286 (COL4A4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   1286 (COL4A4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   1286 (COL4A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 1286
NCBI-ProteinID: NP_000083
OMIM: 120131
HGNC: 2206
Ensembl: ENSG00000081052
Vega: OTTHUMG00000149892
Pharos: P53420(Tbio)
UniProt: P53420
LinkDB All DBs
Structure
PDB: 

Position
2q36.3
AA seq 1690 aa AA seqDB search
MWSLHIVLMRCSFRLTKSLATGPWSLILILFSVQYVYGSGKKYIGPCGGRDCSVCHCVPE
KGSRGPPGPPGPQGPIGPLGAPGPIGLSGEKGMRGDRGPPGAAGDKGDKGPTGVPGFPGL
DGIPGHPGPPGPRGKPGMSGHNGSRGDPGFPGGRGALGPGGPLGHPGEKGEKGNSVFILG
AVKGIQGDRGDPGLPGLPGSWGAGGPAGPTGYPGEPGLVGPPGQPGRPGLKGNPGVGVKG
QMGDPGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGMVGLPGPPGRKGESGIGAKGE
KGIPGFPGPRGDPGSYGSPGFPGLKGELGLVGDPGLFGLIGPKGDPGNRGHPGPPGVLVT
PPLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGPQGFPGLPGLPG
EAGIPGRPDSAPGKPGKPGSPGLPGAPGLQGLPGSSVIYCSVGNPGPQGIKGKVGPPGGR
GPKGEKGNEGLCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWLGTKGDPGPPGAEGPPGL
PGKHGASGPPGNKGAKGDMVVSRVKGHKGERGPDGPPGFPGQPGSHGRDGHAGEKGDPGP
PGDHEDATPGGKGFPGPLGPPGKAGPVGPPGLGFPGPPGERGHPGVPGHPGVRGPDGLKG
QKGDTISCNVTYPGRHGPPGFDGPPGPKGFPGPQGAPGLSGSDGHKGRPGTPGTAEIPGP
PGFRGDMGDPGFGGEKGSSPVGPPGPPGSPGVNGQKGIPGDPAFGHLGPPGKRGLSGVPG
IKGPRGDPGCPGAEGPAGIPGFLGLKGPKGREGHAGFPGVPGPPGHSCERGAPGIPGQPG
LPGYPGSPGAPGGKGQPGDVGPPGPAGMKGLPGLPGRPGAHGPPGLPGIPGPFGDDGLPG
PPGPKGPRGLPGFPGFPGERGKPGAEGCPGAKGEPGEKGMSGLPGDRGLRGAKGAIGPPG
DEGEMAIISQKGTPGEPGPPGDDGFPGERGDKGTPGMQGRRGEPGRYGPPGFHRGEPGEK
GQPGPPGPPGPPGSTGLRGFIGFPGLPGDQGEPGSPGPPGFSGIDGARGPKGNKGDPASH
FGPPGPKGEPGSPGCPGHFGASGEQGLPGIQGPRGSPGRPGPPGSSGPPGCPGDHGMPGL
RGQPGEMGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTKGASGLHDVGPP
GPVGIPGLKGERGDPGSPGISPPGPRGKKGPPGPPGSSGPPGPAGATGRAPKDIPDPGPP
GDQGPPGPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGPPGPPGPPGYKGFPGCDGK
DGQKGPVGFPGPQGPHGFPGPPGEKGLPGPPGRKGPTGLPGPRGEPGPPADVDDCPRIPG
LPGAPGMRGPEGAMGLPGMRGPSGPGCKGEPGLDGRRGVDGVPGSPGPPGRKGDTGEDGY
PGGPGPPGPIGDPGPKGFGPGYLGGFLLVLHSQTDQEPTCPLGMPRLWTGYSLLYLEGQE
KAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMMPLSEEAIR
PYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPG
SCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKI
SRCQVCVKYS
NT seq 5073 nt NT seq  +upstreamnt  +downstreamnt
atgtggtctctgcacatagtactaatgaggtgctccttcagattgaccaagtccttggcc
acaggtccctggtcacttatactcattctcttttctgtacaatatgtatatgggagtgga
aagaaatacattggtccttgtggaggaagagattgctctgtttgccactgtgttcctgaa
aaggggtctcggggtccaccaggaccaccagggccacagggtccaattggacccctggga
gccccaggacccattgggctttcaggagagaaaggaatgagaggggaccgcggccctcct
ggagcagcaggggacaaaggagataagggtccaactggtgttcctggatttccaggttta
gatggcatacctgggcacccagggcctcctggacccagaggcaaacctggtatgagtggc
cacaatggctcaagaggtgacccagggtttccaggaggaagaggagctcttggcccagga
ggccccctaggccatcctggggaaaagggagaaaaaggaaattcagtgttcattttaggt
gccgttaaaggtattcagggagacagaggggacccaggactgcctggcttaccaggatct
tggggtgcaggaggaccggcaggtcccacaggatatcctggagagccagggttagtggga
cctccgggccaaccagggcgtccaggtttgaagggaaatcccggtgtgggagtaaagggg
caaatgggagacccgggtgaggttggtcagcaaggttctcctggacccaccctgttggta
gagccacctgacttttgtctctataaaggagaaaagggtataaaaggaattcctggaatg
gttggactgccaggaccaccaggacgcaagggagaatctggtattggggcaaaaggagaa
aaaggtattcctggatttccagggcctcggggggatcctggttcctatggatctccaggt
tttccaggattaaagggagaactaggactggttggagatcctgggctatttggattaatt
ggcccaaagggggatcctggaaatcgagggcacccaggaccaccaggtgttttggtgact
ccacctcttccactcaaaggcccaccaggggacccagggttccctggccgctatggagaa
acaggggatgttggaccacctggtcccccaggtctcttgggcagaccaggggaagcctgt
gcaggcatgataggaccccctgggccacaaggatttcctggtcttcctgggcttccagga
gaagctggtattcctgggagacctgattctgctccaggaaaaccagggaagccaggatca
cctggcttgcctggagcaccaggcctgcagggcctcccaggatcaagtgtgatatactgt
agtgttgggaaccccggaccacaaggaataaaaggcaaagttggtcccccaggaggaaga
ggcccaaaaggagaaaaaggaaatgaaggactctgtgcctgtgagcctggacccatgggc
ccccctggccctccaggacttcctgggaggcaggggagtaagggagacttggggctccct
ggctggcttggaacaaaaggtgacccaggacctcctggtgctgaaggacctccagggcta
ccaggaaagcatggtgcctctggaccacctggcaacaaaggggcgaagggtgacatggtt
gtatcaagagttaaagggcacaaaggagaaagaggtcctgatgggcccccaggatttcca
gggcagccaggatcacatggtcgggatggacatgctggagaaaaaggggatccaggacct
ccaggggatcatgaagatgcgaccccaggtggtaaaggatttcctggacctctgggcccc
ccaggcaaagcaggacctgtggggcccccaggactgggatttcctggtccaccaggagag
cgaggccacccaggagttccaggccacccaggtgtgaggggccctgatggcttgaagggt
cagaaaggtgacacaatttcttgcaacgtaacctaccctgggaggcatggccctccaggt
tttgatggacctccaggtccgaagggatttccaggtccccaaggtgcccctgggctgagt
ggttcagatgggcataaaggcagacctggcacaccaggaacagcggaaataccaggtcca
cctggttttcgtggtgacatgggagatccgggttttggaggtgaaaaggggtcctcccct
gttgggcccccaggccctcccggctcaccaggagtgaatggtcagaaaggaatcccggga
gaccctgcatttggtcacctgggacccccgggaaagaggggtctttcaggagtgccaggg
ataaaaggacccagaggtgatccgggatgtccaggggctgaagggccagctggcattcct
ggattcctaggtctcaaaggtcccaaaggcagagagggacatgctgggtttccaggtgtc
ccaggtccacctggccattcctgtgaaagaggtgctccagggataccagggcaaccggga
ctccctgggtatccaggtagcccaggtgctccaggtgggaaaggacagccgggagatgtg
gggcctcccgggccagctggaatgaaaggcctccccggactcccaggacggcctggggca
catggtcccccaggcctcccaggaatcccaggtccctttggagatgatgggctacctggt
cctccaggtccaaagggaccccgggggctgcctggtttcccaggttttcccggagaaaga
ggaaagcctggtgcagagggatgtcctggcgcaaagggagaacctggagagaagggcatg
tctggccttcctggagaccggggactgagaggggccaaaggagccataggacctcccgga
gatgaaggagaaatggctatcatttcacaaaagggaacacctggggaacctggacctcct
ggagatgatggattcccaggagaaagaggtgataaaggaactcccgggatgcaagggaga
agaggagagccgggaagatacggaccacctggatttcacagaggggaacctggtgagaaa
ggtcagccagggcctcctggacccccaggccctccaggctcaactggtctaagagggttc
attggttttccaggacttccaggtgaccagggtgagccaggttctccaggtccccctgga
ttttcaggaattgatggagcaagaggacctaaaggaaacaaaggtgaccctgccagtcac
tttggtccacctggtccaaagggtgagccaggtagccctggatgtccagggcattttgga
gcatccggagagcagggcttgcctggtattcaagggcccagaggatcacctggaaggcca
gggccacctggctcctctggaccaccagggtgcccaggtgatcacgggatgcctgggctg
aggggacagccaggagaaatgggagaccctgggccaagaggcctccagggggatccaggg
ataccaggtcctccgggaataaaaggtccctccggatcacctggcctgaacggcttgcat
ggattgaaaggtcagaaaggaactaaaggtgcttcaggtttgcatgatgtggggccacct
ggtccagtgggaatacctgggctaaaaggggagagaggagaccctgggagcccaggaatc
tctcctccaggtcctcgtggaaagaaaggtcccccaggacccccagggagttcaggacca
cctggtcctgcaggtgccacaggaagagctcctaaggacattcctgacccgggtccacct
ggagatcagggacctcctggtcctgatggcccaagaggagcacctgggcctccaggcctc
cctgggagtgttgaccttctgagaggggagccaggtgactgtggtctaccagggccacca
ggtccccctggcccaccaggccctccaggatacaaaggctttccaggatgtgatggaaaa
gatggccagaaaggaccagtgggattcccgggaccgcagggaccacatggatttcctggg
ccacctggagagaagggtttacctggacctccagggagaaaagggcccactggtcttccg
ggtcccagaggtgaaccggggccacctgcagatgtggatgactgtccccgaatcccaggc
cttcctggggcgccaggcatgagaggaccagaaggagccatggggctccctggaatgaga
ggcccctcaggaccagggtgcaaaggagagcctgggctggatggcaggaggggtgtggat
ggcgtccctgggtctcctgggcctcccggacgtaaaggtgacacaggagaagacggctac
cctggaggaccagggcctcctggtcccattggggatcctgggcccaaagggtttggccct
ggatacctcggtggcttcctcctggttctccacagtcagacggaccaggagcccacctgc
cccctgggcatgcccaggctctggactgggtatagtctgttatacctggaagggcaagag
aaagctcacaatcaagaccttggtctggcagggtcttgccttcccgtatttagcacgctg
ccctttgcctactgcaacatccaccaggtgtgccactatgcccagagaaacgacagatcc
tactggctggccagcgctgcgcccctccccatgatgccactctctgaagaggcgatccgc
ccctatgtcagccgctgtgcggtatgcgaggccccggcccaggcggtggcggtgcacagc
caggaccagtccatccccccatgtccgcagacctggaggagcctctggatcgggtattca
ttcctgatgcacacaggagctggggaccaaggaggagggcaggcccttatgtcacctggc
agctgcctggaagatttcagagcagcaccattccttgaatgccagggccggcagggaact
tgccactttttcgcaaataagtatagcttctggctcacaacggtgaaagcagacttgcag
ttttcctctgctccagcaccagacaccttaaaagaaagccaggcccaacgccagaaaatc
agccggtgccaggtctgcgtgaagtatagctag

DBGET integrated database retrieval system