KEGG   Homo sapiens (human): 128866Help
Entry
128866            CDS       T01001                                 

Gene name
CHMP4B, C20orf178, CHMP4A, CTPP3, CTRCT31, SNF7, SNF7-2, Shax1, VPS32B, Vps32-2, dJ553F4.4
Definition
(RefSeq) charged multivesicular body protein 4B
  KO
K12194  charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    128866 (CHMP4B)
  09143 Cell growth and death
   04217 Necroptosis
    128866 (CHMP4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    128866 (CHMP4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    128866 (CHMP4B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    128866 (CHMP4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128866 (CHMP4B)
  Exosomal proteins of other body fluids (saliva and urine)
   128866 (CHMP4B)
  Exosomal proteins of colorectal cancer cells
   128866 (CHMP4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 SYF2 WD-3 Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 128866
NCBI-ProteinID: NP_789782
OMIM: 610897
HGNC: 16171
Ensembl: ENSG00000101421
Vega: OTTHUMG00000032272
Pharos: Q9H444(Tbio)
UniProt: Q9H444
LinkDB All DBs
Structure
PDB: 

Position
20q11.22
AA seq 224 aa AA seqDB search
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttcgggaagctgttcggggctggagggggtaaggccggcaagggcggcccg
accccccaggaggccatccagcggctgcgggacacggaagagatgttaagcaagaaacag
gagttcctggagaagaaaatcgagcaggagctgacggccgccaagaagcacggcaccaaa
aacaagcgcgcggccctccaggcactgaagcgtaagaagaggtatgagaagcagctggcg
cagatcgacggcacattatcaaccatcgagttccagcgggaggccctggagaatgccaac
accaacaccgaggtgctcaagaacatgggctatgccgccaaggccatgaaggcggcccat
gacaacatggacatcgataaagttgatgagttaatgcaggacattgctgaccagcaagaa
cttgcagaggagatttcaacagcaatttcgaaacctgtagggtttggagaagagtttgac
gaggatgagctcatggcggaattagaagaactagaacaggaggaactagacaagaatttg
ctggaaatcagtggacccgaaacagtccctctaccaaatgttccctctatagccctacca
tcaaaacccgccaagaagaaagaagaggaggacgacgacatgaaggaattggagaactgg
gctggatccatgtaa

KEGG   Homo sapiens (human): 29082Help
Entry
29082             CDS       T01001                                 

Gene name
CHMP4A, C14orf123, CHMP4, CHMP4B, HSPC134, SHAX2, SNF7, SNF7-1, VPS32-1, VPS32A
Definition
(RefSeq) charged multivesicular body protein 4A
  KO
K12194  charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29082 (CHMP4A)
  09143 Cell growth and death
   04217 Necroptosis
    29082 (CHMP4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29082 (CHMP4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    29082 (CHMP4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    29082 (CHMP4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29082 (CHMP4A)
  Exosomal proteins of other body fluids (saliva and urine)
   29082 (CHMP4A)
  Exosomal proteins of colorectal cancer cells
   29082 (CHMP4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 GHL5 Ribonuc_2-5A
Motif
Other DBs
NCBI-GeneID: 29082
NCBI-ProteinID: NP_054888
OMIM: 610051
HGNC: 20274
Ensembl: ENSG00000254505
Vega: OTTHUMG00000167036
Pharos: Q9BY43(Tbio)
UniProt: Q9BY43
LinkDB All DBs
Position
14q12
AA seq 222 aa AA seqDB search
MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKR
AALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDM
DIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNV
GDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtctcggcaggctcttcgggaaggggaagaaggagaaagggccaacccctgaa
gaagcaatacagaaactgaaggagacagagaagatactgatcaagaaacaggaatttttg
gagcagaagattcaacaggagctacaaacagccaagaagtatgggaccaagaataagaga
gctgccctacaggctttgcggaggaagaaaagattcgaacagcagctggcacaaactgac
gggacattatccaccctggagtttcagcgtgaggccattgagaatgccactaccaatgca
gaagtccttcgtaccatggagcttgctgcccaaagcatgaagaaggcctaccaggacatg
gacattgacaaggtagatgaactgatgactgacatcacggaacaacaggaggtggcccag
cagatctcagatgccatttctcggcctatgggctttggagatgatgtggatgaggatgaa
ctgctggaggagctagaggagctggagcaggaggaattggcccaggagttgttaaatgtg
ggcgacaaggaagaagaaccctcagtcaaattgcctagtgtaccttctactcatctgccg
gcagggccagctcccaaagtggatgaagatgaagaagcactaaagcagttggctgagtgg
gtatcctga

KEGG   Homo sapiens (human): 92421Help
Entry
92421             CDS       T01001                                 

Gene name
CHMP4C, SNF7-3, Shax3, VPS32C
Definition
(RefSeq) charged multivesicular body protein 4C
  KO
K12194  charged multivesicular body protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    92421 (CHMP4C)
  09143 Cell growth and death
   04217 Necroptosis
    92421 (CHMP4C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    92421 (CHMP4C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92421 (CHMP4C)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    92421 (CHMP4C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   92421 (CHMP4C)
  Exosomal proteins of other body fluids (saliva and urine)
   92421 (CHMP4C)
  Exosomal proteins of colorectal cancer cells
   92421 (CHMP4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 DUF155 SYF2
Motif
Other DBs
NCBI-GeneID: 92421
NCBI-ProteinID: NP_689497
OMIM: 610899
HGNC: 30599
Ensembl: ENSG00000164695
Vega: OTTHUMG00000164726
Pharos: Q96CF2(Tbio)
UniProt: Q96CF2
LinkDB All DBs
Position
8q21.13
AA seq 233 aa AA seqDB search
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVH
ENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttgggcaagttctttaaagggggcggctcttctaagagccgagccgctccc
agtccccaggaggccctggtccgacttcgggagactgaggagatgctgggcaagaaacaa
gagtacctggaaaatcgaatccagagagaaatcgccctggccaagaagcacggcacgcag
aataagcgagctgcattacaggcactaaagagaaagaagaggttcgagaaacagctcact
cagattgatggcacactttctaccattgagttccagagagaagccctggagaactcacac
accaacactgaggtgttgaggaacatgggctttgcagcaaaagcgatgaaatctgttcat
gaaaacatggatctgaacaaaatagatgatttgatgcaagagatcacagagcaacaggat
atcgcccaagaaatctcagaagcattttctcaacgggttggctttggtgatgactttgat
gaggatgagttgatggcagaacttgaagaattggaacaggaggaattaaataagaagatg
acaaatatccgccttccaaatgtgccttcctcttctctcccagcacagccaaatagaaaa
ccaggcatgtcgtccactgcacgtcgatcccgagcagcatcttcccagagggcagaagaa
gaggatgatgatatcaaacaattggcagcttgggctacctaa

DBGET integrated database retrieval system