KEGG   Homo sapiens (human): 130399Help
Entry
130399            CDS       T01001                                 

Gene name
ACVR1C, ACVRLK7, ALK7
Definition
(RefSeq) activin A receptor type 1C
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    130399 (ACVR1C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    130399 (ACVR1C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    130399 (ACVR1C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    130399 (ACVR1C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     130399 (ACVR1C)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   130399 (ACVR1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 130399
NCBI-ProteinID: NP_660302
OMIM: 608981
HGNC: 18123
Ensembl: ENSG00000123612
Vega: OTTHUMG00000131964
Pharos: Q8NER5(Tbio)
UniProt: Q8NER5
LinkDB All DBs
Position
2q24.1
AA seq 493 aa AA seqDB search
MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITV
PVCLLSIAAMLTVWACQGRQCSYRKKKRPNVEEPLSECNLVNAGKTLKDLIYDVTASGSG
SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ
TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIA
SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQN
PKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD
MVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKK
TISQLCVKEDCKA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggcgctctgctcagcgctccgccaggctctcctgctgctcgcagcggccgcc
gagctctcgccaggactgaagtgtgtatgtcttttgtgtgattcttcaaacttcacctgc
caaacagaaggagcatgttgggcatcagtcatgctaaccaatggaaaagagcaggtgatc
aaatcctgtgtctcccttccagaactgaatgctcaagtcttctgtcatagttccaacaat
gttaccaaaaccgaatgctgcttcacagatttttgcaacaacataacactgcaccttcca
acagcatcaccaaatgccccaaaacttggacccatggagctggccatcattattactgtg
cctgtttgcctcctgtccatagctgcgatgctgacagtatgggcatgccagggtcgacag
tgctcctacaggaagaaaaagagaccaaatgtggaggaaccactctctgagtgcaatctg
gtaaatgctggaaaaactctgaaagatctgatttatgatgtgaccgcctctggatctggc
tctggtctacctctgttggttcaaaggacaattgcaaggacgattgtgcttcaggaaata
gtaggaaaaggtagatttggtgaggtgtggcatggaagatggtgtggggaagatgtggct
gtgaaaatattctcctccagagatgaaagatcttggtttcgtgaggcagaaatttaccag
acggtcatgctgcgacatgaaaacatccttggtttcattgctgctgacaacaaagataat
ggaacttggactcaactttggctggtatctgaatatcatgaacagggctccttatatgac
tatttgaatagaaatatagtgaccgtggctggaatgatcaagctggcgctctcaattgct
agtggtctggcacaccttcatatggagattgttggtacacaaggtaaacctgctattgct
catcgagacataaaatcaaagaatatcttagtgaaaaagtgtgaaacttgtgccatagcg
gacttagggttggctgtgaagcatgattcaatactgaacactatcgacatacctcagaat
cctaaagtgggaaccaagaggtatatggctcctgaaatgcttgatgatacaatgaatgtg
aatatctttgagtccttcaaacgagctgacatctattctgttggtctggtttactgggaa
atagcccggaggtgttcagtcggaggaattgttgaggagtaccaattgccttattatgac
atggtgccttcagatccctcgatagaggaaatgagaaaggttgtttgtgaccagaagttt
cgaccaagtatcccaaaccagtggcaaagttgtgaagcactccgagtcatggggagaata
atgcgtgagtgttggtatgccaacggagcggcccgcctaactgctcttcgtattaagaag
actatatctcaactttgtgtcaaagaagactgcaaagcctaa

DBGET integrated database retrieval system