KEGG   Homo sapiens (human): 1311Help
Entry
1311              CDS       T01001                                 

Gene name
COMP, EDM1, EPD1, MED, PSACH, THBS5, TSP5
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
Disease
H00476  Multiple epiphyseal dysplasia
H00477  Pseudoachondroplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    1311 (COMP)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    1311 (COMP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    1311 (COMP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1311 (COMP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    1311 (COMP)
  09174 Infectious disease: parasitic
   05144 Malaria
    1311 (COMP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1311 (COMP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1311 (COMP)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1311 (COMP)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    1311 (COMP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1311 (COMP)
  Exosomal proteins of colorectal cancer cells
   1311 (COMP)
  Exosomal proteins of bladder cancer cells
   1311 (COMP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   1311 (COMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF_MSP1_1 EGF hEGF
Motif
Other DBs
NCBI-GeneID: 1311
NCBI-ProteinID: NP_000086
OMIM: 600310
HGNC: 2227
Ensembl: ENSG00000105664
Vega: OTTHUMG00000169318
Pharos: P49747(Tbio)
UniProt: P49747
LinkDB All DBs
Structure
PDB: 

Position
19p13.11
AA seq 757 aa AA seqDB search
MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEH
ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK
DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS
RDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD
PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT
ESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG
RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgacaccgcctgcgttcttctgctcaccctggctgccctcggcgcgtccgga
cagggccagagcccgttgggctcagacctgggcccgcagatgcttcgggaactgcaggaa
accaacgcggcgctgcaggacgtgcgggagctgctgcggcagcaggtcagggagatcacg
ttcctgaaaaacacggtgatggagtgtgacgcgtgcgggatgcagcagtcagtacgcacc
ggcctacccagcgtgcggcccctgctccactgcgcgcccggcttctgcttccccggcgtg
gcctgcatccagacggagagcggcgcgcgctgcggcccctgccccgcgggcttcacgggc
aacggctcgcactgcaccgacgtcaacgagtgcaacgcccacccctgcttcccccgagtc
cgctgtatcaacaccagcccggggttccgctgcgaggcttgcccgccggggtacagcggc
cccacccaccagggcgtggggctggctttcgccaaggccaacaagcaggtttgcacggac
atcaacgagtgtgagaccgggcaacataactgcgtccccaactccgtgtgcatcaacacc
cggggctccttccagtgcggcccgtgccagcccggcttcgtgggcgaccaggcgtccggc
tgccagcggcgcgcacagcgcttctgccccgacggctcgcccagcgagtgccacgagcat
gcagactgcgtcctagagcgcgatggctcgcggtcgtgcgtgtgtgccgttggctgggcc
ggcaacgggatcctctgtggtcgcgacactgacctagacggcttcccggacgagaagctg
cgctgcccggagcgccagtgccgtaaggacaactgcgtgactgtgcccaactcagggcag
gaggatgtggaccgcgatggcatcggagacgcctgcgatccggatgccgacggggacggg
gtccccaatgaaaaggacaactgcccgctggtgcggaacccagaccagcgcaacacggac
gaggacaagtggggcgatgcgtgcgacaactgccggtcccagaagaacgacgaccaaaag
gacacagaccaggacggccggggcgatgcgtgcgacgacgacatcgacggcgaccggatc
cgcaaccaggccgacaactgccctagggtacccaactcagaccagaaggacagtgatggc
gatggtataggggatgcctgtgacaactgtccccagaagagcaacccggatcaggcggat
gtggaccacgactttgtgggagatgcttgtgacagcgatcaagaccaggatggagacgga
catcaggactctcgggacaactgtcccacggtgcctaacagtgcccaggaggactcagac
cacgatggccagggtgatgcctgcgacgacgacgacgacaatgacggagtccctgacagt
cgggacaactgccgcctggtgcctaaccccggccaggaggacgcggacagggacggcgtg
ggcgacgtgtgccaggacgactttgatgcagacaaggtggtagacaagatcgacgtgtgt
ccggagaacgctgaagtcacgctcaccgacttcagggccttccagacagtcgtgctggac
ccggagggtgacgcgcagattgaccccaactgggtggtgctcaaccagggaagggagatc
gtgcagacaatgaacagcgacccaggcctggctgtgggttacactgccttcaatggcgtg
gacttcgagggcacgttccatgtgaacacggtcacggatgacgactatgcgggcttcatc
tttggctaccaggacagctccagcttctacgtggtcatgtggaagcagatggagcaaacg
tattggcaggcgaaccccttccgtgctgtggccgagcctggcatccaactcaaggctgtg
aagtcttccacaggccccggggaacagctgcggaacgctctgtggcatacaggagacaca
gagtcccaggtgcggctgctgtggaaggacccgcgaaacgtgggttggaaggacaagaag
tcctatcgttggttcctgcagcaccggccccaagtgggctacatcagggtgcgattctat
gagggccctgagctggtggccgacagcaacgtggtcttggacacaaccatgcggggtggc
cgcctgggggtcttctgcttctcccaggagaacatcatctgggccaacctgcgttaccgc
tgcaatgacaccatcccagaggactatgagacccatcagctgcggcaagcctag

KEGG   Homo sapiens (human): 7057Help
Entry
7057              CDS       T01001                                 

Gene name
THBS1, THBS, THBS-1, TSP, TSP-1, TSP1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04115  p53 signaling pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    7057 (THBS1)
   04350 TGF-beta signaling pathway
    7057 (THBS1)
   04151 PI3K-Akt signaling pathway
    7057 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7057 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7057 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    7057 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7057 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    7057 (THBS1)
   05205 Proteoglycans in cancer
    7057 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    7057 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7057 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    7057 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7057 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7057 (THBS1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    7057 (THBS1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   7057 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA Laminin_G_3 cEGF Laminin_G_2 EGF Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 7057
NCBI-ProteinID: NP_003237
OMIM: 188060
HGNC: 11785
Ensembl: ENSG00000137801
Vega: OTTHUMG00000133665
Pharos: P07996(Tbio)
UniProt: P07996
LinkDB All DBs
Structure
PDB: 

Position
15q14
AA seq 1170 aa AA seqDB search
MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactaggcgtcctgttcctgatgcatgtgtgtggcaccaaccgc
attccagagtctggcggagacaacagcgtgtttgacatctttgaactcaccggggccgcc
cgcaaggggtctgggcgccgactggtgaagggccccgacccttccagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgatgacaagttccaagacctggtggat
gctgtgcgggcagaaaagggtttcctccttctggcatccctgaggcagatgaagaagacc
cggggcacgctgctggccctggagcggaaagaccactctggccaggtcttcagcgtggtg
tccaatggcaaggcgggcaccctggacctcagcctgaccgtccaaggaaagcagcacgtg
gtgtctgtggaagaagctctcctggcaaccggccagtggaagagcatcaccctgtttgtg
caggaagacagggcccagctgtacatcgactgtgaaaagatggagaatgctgagttggac
gtccccatccaaagcgtcttcaccagagacctggccagcatcgccagactccgcatcgca
aaggggggcgtcaatgacaatttccagggggtgctgcagaatgtgaggtttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagctctaccagtgtcctcctc
acccttgacaacaacgtggtgaatggttccagccctgccatccgcactaactacattggc
cacaagacaaaggacttgcaagccatctgcggcatctcctgtgatgagctgtccagcatg
gtcctggaactcaggggcctgcgcaccattgtgaccacgctgcaggacagcatccgcaaa
gtgactgaagagaacaaagagttggccaatgagctgaggcggcctcccctatgctatcac
aacggagttcagtacagaaataacgaggaatggactgttgatagctgcactgagtgtcac
tgtcagaactcagttaccatctgcaaaaaggtgtcctgccccatcatgccctgctccaat
gccacagttcctgatggagaatgctgtcctcgctgttggcccagcgactctgcggacgat
ggctggtctccatggtccgagtggacctcctgttctacgagctgtggcaatggaattcag
cagcgcggccgctcctgcgatagcctcaacaaccgatgtgagggctcctcggtccagaca
cggacctgccacattcaggagtgtgacaagagatttaaacaggatggtggctggagccac
tggtccccgtggtcatcttgttctgtgacatgtggtgatggtgtgatcacaaggatccgg
ctctgcaactctcccagcccccagatgaacgggaaaccctgtgaaggcgaagcgcgggag
accaaagcctgcaagaaagacgcctgccccatcaatggaggctggggtccttggtcacca
tgggacatctgttctgtcacctgtggaggaggggtacagaaacgtagtcgtctctgcaac
aaccccacaccccagtttggaggcaaggactgcgttggtgatgtaacagaaaaccagatc
tgcaacaagcaggactgtccaattgatggatgcctgtccaatccctgctttgccggcgtg
aagtgtactagctaccctgatggcagctggaaatgtggtgcttgtccccctggttacagt
ggaaatggcatccagtgcacagatgttgatgagtgcaaagaagtgcctgatgcctgcttc
aaccacaatggagagcaccggtgtgagaacacggaccccggctacaactgcctgccctgc
cccccacgcttcaccggctcacagcccttcggccagggtgtcgaacatgccacggccaac
aaacaggtgtgcaagccccgtaacccctgcacggatgggacccacgactgcaacaagaac
gccaagtgcaactacctgggccactatagcgaccccatgtaccgctgcgagtgcaagcct
ggctacgctggcaatggcatcatctgcggggaggacacagacctggatggctggcccaat
gagaacctggtgtgcgtggccaatgcgacttaccactgcaaaaaggataattgccccaac
cttcccaactcagggcaggaagactatgacaaggatggaattggtgatgcctgtgatgat
gacgatgacaatgataaaattccagatgacagggacaactgtccattccattacaaccca
gctcagtatgactatgacagagatgatgtgggagaccgctgtgacaactgtccctacaac
cacaacccagatcaggcagacacagacaacaatggggaaggagacgcctgtgctgcagac
attgatggagacggtatcctcaatgaacgggacaactgccagtacgtctacaatgtggac
cagagagacactgatatggatggggttggagatcagtgtgacaattgccccttggaacac
aatccggatcagctggactctgactcagaccgcattggagatacctgtgacaacaatcag
gatattgatgaagatggccaccagaacaatctggacaactgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaagatggcaagggagatgcctgtgaccacgatgatgacaac
gatggcattcctgatgacaaggacaactgcagactcgtgcccaatcccgaccagaaggac
tctgacggcgatggtcgaggtgatgcctgcaaagatgattttgaccatgacagtgtgcca
gacatcgatgacatctgtcctgagaatgttgacatcagtgagaccgatttccgccgattc
cagatgattcctctggaccccaaagggacatcccaaaatgaccctaactgggttgtacgc
catcagggtaaagaactcgtccagactgtcaactgtgatcctggactcgctgtaggttat
gatgagtttaatgctgtggacttcagtggcaccttcttcatcaacaccgaaagggacgat
gactatgctggatttgtctttggctaccagtccagcagccgcttttatgttgtgatgtgg
aagcaagtcacccagtcctactgggacaccaaccccacgagggctcagggatactcgggc
ctttctgtgaaagttgtaaactccaccacagggcctggcgagcacctgcggaacgccctg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgtcacata
ggctggaaagatttcaccgcctacagatggcgtctcagccacaggccaaagacgggtttc
attagagtggtgatgtatgaagggaagaaaatcatggctgactcaggacccatctatgat
aaaacctatgctggtggtagactagggttgtttgtcttctctcaagaaatggtgttcttc
tctgacctgaaatacgaatgtagagatccctaa

KEGG   Homo sapiens (human): 7058Help
Entry
7058              CDS       T01001                                 

Gene name
THBS2, TSP2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7058 (THBS2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7058 (THBS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7058 (THBS2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7058 (THBS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7058 (THBS2)
  09174 Infectious disease: parasitic
   05144 Malaria
    7058 (THBS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7058 (THBS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7058 (THBS2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7058 (THBS2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    7058 (THBS2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7058 (THBS2)
  Exosomal proteins of colorectal cancer cells
   7058 (THBS2)
  Exosomal proteins of bladder cancer cells
   7058 (THBS2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   7058 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 TSP_1 VWC EGF_3 EGF_CA EGF cEGF Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 7058
NCBI-ProteinID: NP_003238
OMIM: 188061
HGNC: 11786
Ensembl: ENSG00000186340
Vega: OTTHUMG00000045408
Pharos: P35442(Tbio)
UniProt: P35442
LinkDB All DBs
Structure
PDB: 

Position
6q27
AA seq 1172 aa AA seqDB search
MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
CFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
DNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atggtctggaggctggtcctgctggctctgtgggtgtggcccagcacgcaagctggtcac
caggacaaagacacgaccttcgaccttttcagtatcagcaacatcaaccgcaagaccatt
ggcgccaagcagttccgcgggcccgaccccggcgtgccggcttaccgcttcgtgcgcttt
gactacatcccaccggtgaacgcagatgacctcagcaagatcaccaagatcatgcggcag
aaggagggcttcttcctcacggcccagctcaagcaggacggcaagtccaggggcacgctg
ttggctctggagggccccggtctctcccagaggcagttcgagatcgtctccaacggcccc
gcggacacgctggatctcacctactggattgacggcacccggcatgtggtctccctggag
gacgtcggcctggctgactcgcagtggaagaacgtcaccgtgcaggtggctggcgagacc
tacagcttgcacgtgggctgcgacctcatagacagcttcgctctggacgagcccttctac
gagcacctgcaggcggaaaagagccggatgtacgtggccaaaggctctgccagagagagt
cacttcaggggtttgcttcagaacgtccacctagtgtttgaaaactctgtggaagatatt
ctaagcaagaagggttgccagcaaggccagggagctgagatcaacgccatcagtgagaac
acagagacgctgcgcctgggtccgcatgtcaccaccgagtacgtgggccccagctcggag
aggaggcccgaggtgtgcgaacgctcgtgcgaggagctgggaaacatggtccaggagctc
tcggggctccacgtcctcgtgaaccagctcagcgagaacctcaagagagtgtcgaatgat
aaccagtttctctgggagctcattggtggccctcctaagacaaggaacatgtcagcttgc
tggcaggatggccggttctttgcggaaaatgaaacgtgggtggtggacagctgcaccacg
tgtacctgcaagaaatttaaaaccatttgccaccaaatcacctgcccgcctgcaacctgc
gccagtccatcctttgtggaaggcgaatgctgcccttcctgcctccactcggtggacggt
gaggagggctggtctccgtgggcagagtggacccagtgctccgtgacgtgtggctctggg
acccagcagagaggccggtcctgtgacgtcaccagcaacacctgcttggggccctccatc
cagacacgggcttgcagtctgagcaagtgtgacacccgcatccggcaggacggcggctgg
agccactggtcaccttggtcttcatgctctgtgacctgtggagttggcaatatcacacgc
atccgtctctgcaactccccagtgccccagatggggggcaagaattgcaaagggagtggc
cgggagaccaaagcctgccagggcgccccatgcccaatcgatggccgctggagcccctgg
tccccgtggtcggcctgcactgtcacctgtgccggtgggatccgggagcgcacccgggtc
tgcaacagccctgagcctcagtacggagggaaggcctgcgtgggggatgtgcaggagcgt
cagatgtgcaacaagaggagctgccccgtggatggctgtttatccaacccctgcttcccg
ggagcccagtgcagcagcttccccgatgggtcctggtcatgcggctcctgccctgtgggc
ttcttgggcaatggcacccactgtgaggacctggacgagtgtgccctggtccccgacatc
tgcttctccaccagcaaggtgcctcgctgtgtcaacactcagcctggcttccactgcctg
ccctgcccgccccgatacagagggaaccagcccgtcggggtcggcctggaagcagccaag
acggaaaagcaagtgtgtgagcccgaaaacccatgcaaggacaagacacacaactgccac
aagcacgcggagtgcatctacctgggccacttcagcgaccccatgtacaagtgcgagtgc
cagacaggctacgcgggcgacgggctcatctgcggggaggactcggacctggacggctgg
cccaacctcaatctggtctgcgccaccaacgccacctaccactgcatcaaggataactgc
ccccatctgccaaattctgggcaggaagactttgacaaggacgggattggcgatgcctgt
gatgatgacgatgacaatgacggtgtgaccgatgagaaggacaactgccagctcctcttc
aatccccgccaggctgactatgacaaggatgaggttggggaccgctgtgacaactgccct
tacgtgcacaaccctgcccagatcgacacagacaacaatggagagggtgacgcctgctcc
gtggacattgatggggacgatgtcttcaatgaacgagacaattgtccctacgtctacaac
actgaccagagggacacggatggtgacggtgtgggggatcactgtgacaactgccccctg
gtgcacaaccctgaccagaccgacgtggacaatgaccttgttggggaccagtgtgacaac
aacgaggacatagatgacgacggccaccagaacaaccaggacaactgcccctacatctcc
aacgccaaccaggctgaccatgacagagacggccagggcgacgcctgtgaccctgatgat
gacaacgatggcgtccccgatgacagggacaactgccggcttgtgttcaacccagaccag
gaggacttggacggtgatggacggggtgatatttgtaaagatgattttgacaatgacaac
atcccagatattgatgatgtgtgtcctgaaaacaatgccatcagtgagacagacttcagg
aacttccagatggtccccttggatcccaaagggaccacccaaattgatcccaactgggtc
attcgccatcaaggcaaggagctggttcagacagccaactcggaccccggcatcgctgta
ggttttgacgagtttgggtctgtggacttcagtggcacattctacgtaaacactgaccgg
gacgacgactatgccggcttcgtctttggttaccagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacgcagacctactgggaggaccagcccacgcgggcctatggctac
tccggcgtgtccctcaaggtggtgaactccaccacggggacgggcgagcacctgaggaac
gcgctgtggcacacggggaacacgccggggcaggtgcgaaccttatggcacgaccccagg
aacattggctggaaggactacacggcctataggtggcacctgactcacaggcccaagact
ggctacatcagagtcttagtgcatgaaggaaaacaggtcatggcagactcaggacctatc
tatgaccaaacctacgctggcgggcggctgggtctatttgtcttctctcaagaaatggtc
tatttctcagacctcaagtacgaatgcagagatatttaa

KEGG   Homo sapiens (human): 7059Help
Entry
7059              CDS       T01001                                 

Gene name
THBS3, TSP3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7059 (THBS3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7059 (THBS3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7059 (THBS3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7059 (THBS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7059 (THBS3)
  09174 Infectious disease: parasitic
   05144 Malaria
    7059 (THBS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7059 (THBS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7059 (THBS3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7059 (THBS3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    7059 (THBS3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7059 (THBS3)
  Exosomal proteins of colorectal cancer cells
   7059 (THBS3)
  Exosomal proteins of bladder cancer cells
   7059 (THBS3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   7059 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 7059
NCBI-ProteinID: NP_009043
OMIM: 188062
HGNC: 11787
Ensembl: ENSG00000169231
Vega: OTTHUMG00000035710
Pharos: P49746(Tbio)
UniProt: P49746
LinkDB All DBs
Position
1q22
AA seq 956 aa AA seqDB search
METQELRGALALLLLCFFTSASQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTVLLRLRGPSRPSPALHLYVDCKLGDQHAGLPALAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKGTQVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctttgctttttcacatct
gccagtcaggatctgcaggtaattgacctgctgactgtgggcgagtctcggcagatggta
gctgtggcagagaagatccggacagccttgctcactgctggggacatctacctcttatcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctattctcgccaagac
aacactcgatggctggaggcctctgttgtaggcaagatcaacaaagtactggtgcgatac
cagcgggaggatggcaaagtccacgccgtgaacctacagcaagcgggcctggctgatggg
cgcacacacacagttctcctgcgactccgaggtccctccagacccagccctgccctacat
ctctacgtggactgcaaactgggtgaccaacatgcaggccttccagcactggcccccatt
cctccagcggaggtcgatgggctggagattaggactggacagaaggcgtatttgaggatg
cagggctttgtggaatctatgaaaattattctgggtgggtccatggcccgggtaggagcc
ctgagtgagtgtccattccaaggggacgagtccatccacagtgcagtgaccaatgcactg
cactccattctaggggagcagaccaaggcgctggtcacccaactcaccctcttcaaccag
atcctggtggagctgcgggatgatatacgagaccaggtgaaggaaatgtccctgatccga
aacaccattatggagtgtcaggtgtgcggcttccatgagcagcgttcccactgcagcccc
aatccctgcttccgaggtgtggactgcatggaagtgtacgagtacccaggctaccgctgt
gggccctgcccccctggcctgcagggcaacggcacccactgcagtgacatcaatgagtgt
gctcacgctgacccctgtttcccgggctccagctgcatcaacaccatgcccggcttccac
tgtgaggcctgtcctcgagggtacaagggcacacaggtgtctggtgtgggcattgactat
gcccgggccagcaaacaggtctgcaatgacatcgatgaatgcaacgatggcaacaatggt
ggctgtgacccaaactccatctgcaccaacactgtgggctctttcaagtgtggtccctgc
cgcctgggtttcctgggcaaccagagccagggctgcctcccagcccggacctgccacagc
ccagcccacagcccctgccacatccatgctcactgtctctttgaacgcaatggtgcagtg
tcctgccagtgtaacgtgggctgggctgggaatgggaacgtgtgtgggactgacacagac
atcgatggctacccagaccaagcactgccctgcatggacaacaacaaacactgcaaacag
gacaactgccttttgacacccaactctgggcaggaagatgctgataatgatggtgtgggg
gaccagtgtgatgatgatgctgatggggatgggatcaagaatgttgaggacaactgccgg
ctgttccccaacaaagaccagcagaactcagatacagattcatttggtgatgcctgtgac
aattgccccaacgttcccaacaatgaccagaaggacacagatggcaatggggaaggagat
gcctgtgacaacgacgtggatggggatggcatccccaatggattggacaattgccctaaa
gtccccaacccactacagacagacagggatgaggacggggtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagcgacctggtgggggatgtc
tgtgatactaatgaagacagcgatggggatgggcatcaggacaccaaggacaactgccca
cagctgccaaatagctcccagctggactctgataacgatggacttggagatgagtgtgat
ggggatgatgacaatgatggcatcccagattatgtgcctcctggtcccgataactgccgc
ctggtacccaatcccaatcagaaggactcagatggcaatggcgttggtgatgtgtgtgag
gatgactttgacaatgatgctgtggtcgaccccctggatgtgtgtcctgaaagtgcagag
gtaacgcttacggattttcgggcctatcagaccgtcgtcctggatcctgagggtgatgct
cagattgacccaaactgggttgtgctcaaccagggcatggaaatcgttcagaccatgaac
agtgaccctggcttggcagttggatacacggccttcaatggtgtggactttgaaggcacc
ttccatgtgaacacagtgactgatgatgactacgcaggctttctcttcagttatcaagac
agtggccgcttctacgtagtcatgtggaagcagaccgagcagacctactggcaggctaca
cccttccgggcggttgcccagcccgggctgcagctcaaggcagtgacatcagtgtctggc
ccaggtgagcacctccgaaatgccctgtggcatactggccacacccctgatcaggtacga
ctgctgtggacagacccacgaaatgtgggctggcgggacaagacctcctatcgctggcag
cttctgcaccggcctcaagttggctacattcgggtgaagctctatgagggaccccagctt
gtggcggattctggggtgatcattgacacatccatgcgaggggggcgtcttggtgtattc
tgcttctcccaagaaaacataatttggtccaatctccagtatcgatgcaatgacacagtg
cctgaggactttgagccattccggaggcagctgctccagggaagggtgtga

KEGG   Homo sapiens (human): 7060Help
Entry
7060              CDS       T01001                                 

Gene name
THBS4, TSP-4, TSP4
Definition
(RefSeq) thrombospondin 4
  KO
K04659  thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05144  Malaria
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7060 (THBS4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7060 (THBS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7060 (THBS4)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7060 (THBS4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7060 (THBS4)
  09174 Infectious disease: parasitic
   05144 Malaria
    7060 (THBS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7060 (THBS4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7060 (THBS4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7060 (THBS4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    7060 (THBS4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7060 (THBS4)
  Exosomal proteins of colorectal cancer cells
   7060 (THBS4)
  Exosomal proteins of bladder cancer cells
   7060 (THBS4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   7060 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF
Motif
Other DBs
NCBI-GeneID: 7060
NCBI-ProteinID: NP_003239
OMIM: 600715
HGNC: 11788
Ensembl: ENSG00000113296
Vega: OTTHUMG00000108173
Pharos: P35443(Tbio)
UniProt: P35443
LinkDB All DBs
Position
5q14.1
AA seq 961 aa AA seqDB search
MLAPRGAAVLLLHLVLQRWLAAGAQATPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYV
ISTFKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLA
DGRRHRILLRLSNLQRGAGSLELYLDCIQVDSVHNLPRAFAGPSQKPETIELRTFQRKPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
CTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVHCINLSPGFRCDACPVGFTGP
MVQGVGISFAKSNKQVCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKA
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFG
DACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGD
ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFD
N
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgctggccccgcgcggagccgccgtcctcctgctgcacctggtcctgcagcggtggcta
gcggcaggcgcccaggccaccccccaggtctttgaccttctcccatcttccagtcagagg
ctaaacccaggcgctctgctgccagtcctgacagaccccgccctgaatgatctctatgtg
atttccaccttcaagctgcagactaaaagttcagccaccatcttcggtctttactcttca
actgacaacagtaaatattttgaatttactgtgatgggacgcttaaacaaagccatcctc
cgttacctgaagaacgatgggaaggtgcatttggtggttttcaacaacctgcagctggca
gacggaaggcggcacaggatcctcctgaggctgagcaatttgcagcgaggggccggctcc
ctagagctctacctggactgcatccaggtggattccgttcacaatctccccagggccttt
gctggcccctcccagaaacctgagaccattgaattgaggactttccagaggaagccacag
gacttcttggaagagctgaagctggtggtgagaggctcactgttccaggtggccagcctg
caagactgcttcctgcagcagagtgagccactggctgccacaggcacaggggactttaac
cggcagttcttgggtcaaatgacacaattaaaccaactcctgggagaggtgaaggacctt
ctgagacagcaggttaaggaaacatcatttttgcgaaacaccatagctgaatgccaggct
tgcggtcctctcaagtttcagtctccgaccccaagcacggtggtgcccccggctccccct
gcaccgccaacacgcccacctcgtcggtgtgactccaacccatgtttccgaggtgtccaa
tgtaccgacagtagagatggcttccagtgtgggccctgccccgagggctacacaggaaac
gggatcacctgtattgatgttgatgagtgcaaataccatccctgctacccgggcgtgcac
tgcataaatttgtctcctggcttcagatgtgacgcctgcccagtgggcttcacagggccc
atggtgcagggtgttgggatcagttttgccaagtcaaacaagcaggtctgcactgacatt
gatgagtgtcgaaatggagcgtgcgttcccaactcgatctgcgttaatactttgggatct
taccgctgtgggccttgtaagccggggtatactggtgatcagataaggggatgcaaagcg
gaaagaaactgcagaaacccagagctgaacccttgcagtgtgaatgcccagtgcattgaa
gagaggcagggggatgtgacatgtgtgtgtggagtcggttgggctggagatggctatatc
tgtggaaaggatgtggacatcgacagttaccccgacgaagaactgccatgctctgccagg
aactgtaaaaaggacaactgcaaatatgtgccaaattctggccaagaagatgcagacaga
gatggcattggcgacgcttgtgacgaggatgctgacggagatgggatcctgaatgagcag
gataactgtgtcctgattcataatgtggaccaaaggaacagcgataaagatatctttggg
gatgcctgtgataactgcctgagtgtcttaaataacgaccagaaagacaccgatggggat
ggaagaggagatgcctgtgatgatgacatggatggagatggaataaaaaacattctggac
aactgcccaaaatttcccaatcgtgaccaacgggacaaggatggtgatggtgtgggggat
gcctgtgacagttgtcctgatgtcagcaaccctaaccagtctgatgtggataatgatctg
gttggggactcctgtgacaccaatcaggacagtgatggagatgggcaccaggacagcaca
gacaactgccccaccgtcattaacagtgcccagctggacaccgataaggatggaattggt
gacgagtgtgatgatgatgatgacaatgatggtatcccagacctggtgccccctggacca
gacaactgccggctggtccccaacccagcccaggaggatagcaacagcgacggagtggga
gacatctgtgagtctgactttgaccaggaccaggtcatcgatcggatcgacgtctgccca
gagaacgcagaggtcaccctgaccgacttcagggcttaccagaccgtggtcctggatcct
gaaggggatgcccagatcgatcccaactgggtggtcctgaaccagggcatggagattgta
cagaccatgaacagtgatcctggcctggcagtggggtacacagcttttaatggagttgac
ttcgaagggaccttccatgtgaatacccagacagatgatgactatgcaggctttatcttt
ggctaccaagatagctccagcttctacgtggtcatgtggaagcagacggagcagacatat
tggcaagccaccccattccgagcagttgcagaacctggcattcagctcaaggctgtgaag
tctaagacaggtccaggggagcatctccggaactccctgtggcacacgggggacaccagt
gaccaggtcaggctgctgtggaaggactccaggaatgtgggctggaaggacaaggtgtcc
taccgctggttcctacagcacaggccccaggtgggctacatcagggtacgattttatgaa
ggctctgagttggtggctgactctggcgtcaccatagacaccacaatgcgtggaggccga
cttggcgttttctgcttctctcaagaaaacatcatctggtccaacctcaagtatcgctgc
aatgacaccatccctgaggacttccaagagtttcaaacccagaatttcgaccgcttcgat
aattaa

DBGET integrated database retrieval system