KEGG   Homo sapiens (human): 131890Help
Entry
131890            CDS       T01001                                 

Gene name
GRK7, GPRK7
Definition
(RefSeq) G protein-coupled receptor kinase 7
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    131890 (GRK7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    131890 (GRK7)
  09157 Sensory system
   04744 Phototransduction
    131890 (GRK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    131890 (GRK7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     131890 (GRK7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   131890 (GRK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS Kinase-like
Motif
Other DBs
NCBI-GeneID: 131890
NCBI-ProteinID: NP_631948
OMIM: 606987
HGNC: 17031
Ensembl: ENSG00000114124
Vega: OTTHUMG00000159068
Pharos: Q8WTQ7(Tchem)
UniProt: Q8WTQ7
LinkDB All DBs
Position
3q23
AA seq 553 aa AA seqDB search
MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLC
EQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVATCASAPAPG
NPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKL
FEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKGGEKMALLEK
EILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSAQI
ACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVEMKGGKPITQRAGTNGYMAPE
ILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFT
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYA
KDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCE
EGNSSKSGVCLLL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggtggacatgggggccctggacaacctgatcgccaacaccgcctacctgcaggcccgg
aagccctcggactgcgacagcaaagagctgcagcggcggcggcgtagcctggccctgccc
gggctgcagggctgcgcggagctccgccagaagctgtccctgaacttccacagcctgtgt
gagcagcagcccatcggtcgccgcctcttccgtgacttcctagccacagtgcccacgttc
cgcaaggcggcaaccttcctagaggacgtgcagaactgggagctggccgaggagggaccc
accaaagacagcgcgctgcaggggctggtggccacttgtgcgagtgcccctgccccgggg
aacccgcaacccttcctcagccaggccgtggccaccaagtgccaagcagccaccactgag
gaagagcgagtggctgcagtgacgctggccaaggctgaggccatggctttcttgcaagag
cagccctttaaggatttcgtgaccagcgccttctacgacaagtttctgcagtggaaactc
ttcgagatgcaaccagtgtcagacaagtacttcactgagttcagagtgctggggaaaggt
ggttttggggaggtatgtgccgtccaggtgaaaaacactgggaagatgtatgcctgtaag
aaactggacaagaagcggctgaagaagaaaggtggcgagaagatggctctcttggaaaag
gaaatcttggagaaggtcagcagccctttcattgtctctctggcctatgcctttgagagc
aagacccatctctgccttgtcatgagcctgatgaatgggggagacctcaagttccacatc
tacaacgtgggcacgcgtggcctggacatgagccgggtgatcttttactcggcccagata
gcctgtgggatgctgcacctccatgaactcggcatcgtctatcgggacatgaagcctgag
aatgtgcttctggatgacctcggcaactgcaggttatctgacctggggctggccgtggag
atgaagggtggcaagcccatcacccagagggctggaaccaatggttacatggctcctgag
atcctaatggaaaaggtaagttattcctatcctgtggactggtttgccatgggatgcagc
atttatgaaatggttgctggacgaacaccattcaaagattacaaggaaaaggtcagtaaa
gaggatctgaagcaaagaactctgcaagacgaggtcaaattccagcatgataacttcaca
gaggaagcaaaagatatttgcaggctcttcttggctaagaaaccagagcaacgcttagga
agcagagaaaagtctgatgatcccaggaaacatcatttctttaaaacgatcaactttcct
cgcctggaagctggcctaattgaacccccatttgtgccagacccttcagtggtttatgcc
aaagacatcgctgaaattgatgatttctctgaggttcggggggtggaatttgatgacaaa
gataagcagttcttcaaaaactttgcgacaggtgctgttcctatagcatggcaggaagaa
attatagaaacgggactgtttgaggaactgaatgaccccaacagacctacgggttgtgag
gagggtaattcatccaagtctggcgtgtgtttgttattgtaa

DBGET integrated database retrieval system