KEGG   Homo sapiens (human): 132660Help
Entry
132660            CDS       T01001                                 

Gene name
LIN54, CXCDC1, JC8.6, MIP120, TCX1
Definition
(RefSeq) lin-54 DREAM MuvB core complex component
  KO
K21776  protein lin-54
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    132660 (LIN54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TCR MSL2-CXC
Motif
Other DBs
NCBI-GeneID: 132660
NCBI-ProteinID: NP_919258
OMIM: 613367
HGNC: 25397
Ensembl: ENSG00000189308
Vega: OTTHUMG00000130287
Pharos: Q6MZP7(Tdark)
UniProt: Q6MZP7 A0A024RDD8 Q7Z3G2
LinkDB All DBs
Structure
PDB: 

Position
4q21.22
AA seq 749 aa AA seqDB search
MEVVPAEVNSLLPEEIMDTGITLVDDDSIEAVIVSSPIPMETELEEIVNINSTGDSTATP
ISTEPITVYSNHTNQVAVNTTITKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKV
SQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTTQAQSGDAKLPP
QQIKVVTIGGRPEVKPVIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGP
VITKLIFAKPINSKAVTGQTTQVSPPVIAGRVLSQSTPGTPSKTITISESGVIGSTLNST
TQTPNKIAISPLKSPNKAVKSTVQTITVGGVSTSQFKTIIPLATAPNVQQIQVPGSKFHY
VRLVTATSASSSTQPVSQNPSTNTQPLQQAKPVVVNTTPVRMSVPIVSAQAVKQVVPKPI
NPTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQ
LQQSSYVSIASNSTFTGTSGIQTQARLPFNGIIPSESASRPRKPCNCTKSLCLKLYCDCF
ANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCN
CKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKT
KLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAER
MILEEFGRCLMSVINSAGKAKSDPCAMNC
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggtgccagctgaggtgaatagtttgcttccagaggaaataatggacactggt
ataactttagtggatgatgatagtattgaggctgttattgtttcatccccaattcccatg
gagacagaactggaagaaattgtcaacataaattctactggtgactctacagccacgccc
atttccacggaaccaatcacagtgtacagtaaccacactaaccaagttgcagtgaatacc
acaattactaaagcagattctaataccacagtgaaaccagcttttccaagtggccttcaa
aaacttggtgctcagactcctgtgactatatcagccaatcagattattttaaacaaagta
tcacagacatctgatcttaaacttggcaatcagacccttaaaccagatggacagaagtta
attttaacaactttgggcaagtctggttcaccaattgttttagcactaccccatagccaa
ctaccccaggctcagaaagttacaactcaggcccagtcaggagatgctaagttaccaccg
cagcaaattaaagtagttaccattggagggaggccagaggtgaaacctgtcattggtgtc
tcagcattgaccccaggaagtcaactgattaatactacaactcagccctctgtgttacag
acccaacagttaaaaacagtacagattgctaagaagcctcgaacgccaacctctggtcca
gtaatcacgaagctgatctttgcaaaaccaattaatagtaaagcagttacaggacagaca
actcaagtttcaccaccagttattgcaggtagggttctttcacagtctactcccggaact
ccatcaaagaccataacaatatctgaaagtggtgttattggatcaactttaaattctaca
acacagacaccaaataaaatagccatctcacctttgaaatcgccaaataaggcagtgaaa
tcaactgtgcagaccatcactgttggaggagtgagcacatcacagtttaagacaattatt
cctctggcaactgctcccaatgtccagcagattcaagtgcctggaagcaagtttcattat
gtccgacttgttactgccacatcagccagtagctcaacccagccagttagtcagaatccc
agtacaaacactcagcctcttcagcaagcaaagccagtggttgttaatacaaccccagtg
cggatgtcagttccaattgtctcagctcaggctgtcaaacaagttgttccaaaaccaatc
aatccaacttcacaaatagtaactactagccagccacagcaacggcttatcatgcctgcc
acaccactgccacagatccagcccaacctcactaacctgccaccaggcactgtcctggca
ccagctccgggaacagggaatgtgggttatgcagtgcttccagctcagtatgttactcag
ctacagcagtcttcatatgtatcaatagcaagcaactctacctttactggaacatctggt
atccagacccaggcacggcttccattcaatggcataatcccatcagagtcggccagtcgg
ccccgaaagccctgtaattgtacaaaatcactgtgtttgaaattgtattgtgattgcttt
gcaaatggtgaattttgcaacaactgcaattgtactaattgttacaacaatttggaacat
gaaaatgaaaggcaaaaagcaataaaggcatgccttgacagaaatccagaagcctttaag
cctaagatagggaaaggaaaggagggagaatctgatcgacgtcatagcaaagggtgtaat
tgcaaacgatcaggatgtcttaaaaactactgtgaatgctatgaggcaaaaataatgtgt
tcctcaatatgcaaatgtattggctgtaagaattttgaagaaagcccggaaaggaagaca
ttgatgcatttggcagatgcagctgaagtaagggtacagcaacaaacagcagccaagacg
aagttatcctctcaaatttcagacttgcttactaggccaacaccagctttaaatagtgga
ggcggaaaattgccatttacatttgtaactaaggaagtagctgaagccacatgtaattgc
ctccttgcccaggcagagcaggcagacaagaagggaaaatcaaaggcagcagcggaacgg
atgatacttgaggaattcggacgatgtttgatgagtgtcatcaactctgcaggaaaggca
aaaagtgacccttgtgccatgaattgctaa

KEGG   Homo sapiens (human): 286826Help
Entry
286826            CDS       T01001                                 

Gene name
LIN9, BARA, BARPsv, Lin-9, TGS, TGS1, TGS2
Definition
(RefSeq) lin-9 DREAM MuvB core complex component
  KO
K21773  protein lin-9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    286826 (LIN9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIRP DUF2664 Rotavirus_VP1 FTA4
Motif
Other DBs
NCBI-GeneID: 286826
NCBI-ProteinID: NP_775106
OMIM: 609375
HGNC: 30830
Ensembl: ENSG00000183814
Vega: OTTHUMG00000037557
Pharos: Q5TKA1(Tbio)
UniProt: Q5TKA1
LinkDB All DBs
Structure
PDB: 

Position
1q42.12
AA seq 558 aa AA seqDB search
MHRGGQPLKKRRGSFKMAELDQLPDESSSAKALVSLKEGSLSNTWNEKYSSLQKTPVWKG
RNTSSAVEMPFRNSKRSRLFSDEDDRQINTRSPKRNQRVAMVPQKFTATMSTPDKKASQK
IGFRLRNLLKLPKAHKWCIYEWFYSNIDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWG
KIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVADVSQFKDLPDEIPLPLVIGT
KVTARLRGVHDGLFTGQIDAVDTLNATYRVTFDRTGLGTHTIPDYEVLSNEPHETMPIAA
FGQKQRPSRFFMTPPRLHYTPPLQSPIIDNDPLLGQSPWRSKISGSDTETLGGFPVEFLI
QVTRLSKILMIKKEHIKKLREMNTEAEKLKSYSMPISIEFQRRYATIVLELEQLNKDLNK
VLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLI
SRLTAILLQIKCLAEGGDLNSFEFKSLTDSLNDIKSTIDASNISCFQNNVEIHVAHIQSG
LSQMGNLHAFAANNTNRD
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcggcgggcagcctttgaaaaagcggcgcggctcgttcaagatggcggagctc
gaccagttgcctgacgagagctcttcagcaaaagcccttgtcagtttaaaagaaggaagc
ttatctaacacgtggaatgaaaagtacagttctttacagaaaacacctgtttggaaaggc
aggaatacaagctctgctgtggaaatgcctttcagaaattcaaaacgaagtcgacttttt
tctgatgaagatgataggcaaataaatacaaggtcacctaaaagaaaccagagggttgca
atggttccacagaaatttacagcaacaatgtcaacaccagataagaaagcttcacagaag
attggttttcgattacgtaatctgctcaagcttcctaaagcacataaatggtgtatatac
gagtggttctattcaaatatagataaaccactttttgaaggtgataatgacttctgtgta
tgtctaaaggaatcttttcctaatttgaaaacaagaaagttaacaagagtagaatgggga
aaaattcggcggcttatgggaaaaccacggagatgttcttctgcattttttgaggaagag
agatcagcattaaaacagaaacggcagaaaataaggctcttacaacaaaggaaagttgca
gatgtttcacaattcaaagatctcccagatgaaattcctttgcctctggttattggaacg
aaagttacagcacgattacgtggtgttcatgatggtttgttcactggacaaatagatgct
gtggatactcttaatgctacttatagagtaacttttgataggacagggcttggaacccat
accatccctgactatgaagttctcagtaatgaacctcatgagacaatgccaattgctgcc
tttggacaaaaacagcggccttctcgattttttatgaccccaccacggttacattatact
cctcctctccagtcaccaattatagataatgatcctttattaggacagtcgccgtggaga
agtaaaatttctggctctgacactgaaacattaggtggttttccagtagaatttcttatc
caagtgaccagattatcaaaaattctcatgattaaaaaggaacatatcaagaaattaagg
gaaatgaacacagaagcagaaaaattgaaatcatattccatgcccatcagcattgaattt
cagcggagatatgcaacaattgttctggagcttgaacagctgaacaaggacctaaacaaa
gttttgcataaagttcaacagtattgctatgagcttgctccagaccaggggctccagcct
gcagatcagccaacagatatgagacgcaggtgtgaggaagaagcacaggaaattgttcgg
catgcaaattcctcaacaggacagccctgcgttgaaaatgaaaatctgacagacttaatt
tccaggcttacagctattttgttacaaattaagtgtctagcagaaggaggagacctgaat
tcctttgaattcaaatcacttacagactcattaaatgatatcaagagtacaatagacgct
tctaatatcagttgctttcagaataatgtagaaatccatgttgcacatattcagagtggc
ctgagccagatgggaaacttacatgcctttgcagcaaataacaccaacagagactga

KEGG   Homo sapiens (human): 55957Help
Entry
55957             CDS       T01001                                 

Gene name
LIN37, F25965, ZK418.4, lin-37
Definition
(RefSeq) lin-37 DREAM MuvB core complex component
  KO
K21774  protein lin-37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    55957 (LIN37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIN37
Motif
Other DBs
NCBI-GeneID: 55957
NCBI-ProteinID: NP_061977
HGNC: 33234
Ensembl: ENSG00000267796
Vega: OTTHUMG00000182070
Pharos: Q96GY3(Tdark)
UniProt: Q96GY3
LinkDB All DBs
Position
19q13.12
AA seq 246 aa AA seqDB search
MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAA
TGKRPSARFPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
AWMRNSPSVRERECSPSSPLPPLPEDEEGSEVTNSKSRDVYKLPPPTPPGPPGDACRSRI
PSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILR
EMYERQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttccctgtgaaggtgaaagtggagaaatcagagctggagatggccaaagcccggaac
caactggatgctgtcttgcagtgtctgctggagaagagtcacatggacagggagcgtctg
gatgaggaagctgggaaaacaccctcagacacccacaataaggactgctccatcgcagcc
actggcaaaaggccatctgcccgcttcccccaccagcggaggaagaagaggagggagatg
gatgatgggctggctgagggagggccgcagcgatccaacacatatgtgatcaagctgttc
gaccggagcgtggacttggcccagttcagcgagaacacgccactgtacccaatctgccgc
gcctggatgcgcaacagcccctctgtgcgcgagcgtgaatgctctcccagctcacccctg
cccccgctgcctgaggatgaggagggctcagaggtaaccaacagcaagagtcgtgatgtg
tacaagctgccgccacccacacccccggggccacccggagatgcctgcagatcccgcatc
ccatctccactgcagcctgagatgcagggcacccctgacgatgagccctctgagcccgag
ccctcaccctccacactcatctatcgcaacatgcagcgctggaaacgcatccgccagagg
tggaaggaggcctctcatcggaaccagcttcgttactcagaaagcatgaagatcctacga
gagatgtacgaacgacagtga

KEGG   Homo sapiens (human): 5928Help
Entry
5928              CDS       T01001                                 

Gene name
RBBP4, NURF55, RBAP48, lin-53
Definition
(RefSeq) RB binding protein 4, chromatin remodeling factor
  KO
K10752  histone-binding protein RBBP4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    5928 (RBBP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5928 (RBBP4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     5928 (RBBP4)
  Histone modification proteins
   HAT complexes
    HATB complex
     5928 (RBBP4)
   HDAC complexes
    Sin3A-HDAC complex
     5928 (RBBP4)
   Polycomb group proteins
    PRC2-EZH1 complex
     5928 (RBBP4)
    PRC2-EZH2 complex
     5928 (RBBP4)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     5928 (RBBP4)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    5928 (RBBP4)
  Chromatin remodeling factors
   NuRD complex
    5928 (RBBP4)
   NuRF complex
    5928 (RBBP4)
   NuRF complex (fruit fly)
    5928 (RBBP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAF1C_H4-bd WD40 ANAPC4_WD40 eIF2A Capsid_NCLDV
Motif
Other DBs
NCBI-GeneID: 5928
NCBI-ProteinID: NP_005601
OMIM: 602923
HGNC: 9887
Ensembl: ENSG00000162521
Vega: OTTHUMG00000007998
Pharos: Q09028(Tbio)
UniProt: Q09028
LinkDB All DBs
Structure
PDB: 

Position
1p35.1
AA seq 425 aa AA seqDB search
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggaagcagccttcgacgacgcagtggaagaacgagtgatcaacgaggaa
tacaaaatatggaaaaagaacaccccttttctttatgatttggtgatgacccatgctctg
gagtggcccagcctaactgcccagtggcttccagatgtaaccagaccagaagggaaagat
ttcagcattcatcgacttgtcctggggacacacacatcggatgaacaaaaccatcttgtt
atagccagtgtgcagctccctaatgatgatgctcagtttgatgcgtcacactacgacagt
gagaaaggagaatttggaggttttggttcagttagtggaaaaattgaaatagaaatcaag
atcaaccatgaaggagaagtaaacagggcccgttatatgccccagaacccttgtatcatc
gcaacaaagactccttccagtgatgttcttgtttttgactatacaaaacatccttctaaa
ccagatccttctggagagtgcaacccagacttgcgtctccgtggacatcagaaggaaggc
tatgggctttcttggaacccaaatctcagtgggcacttacttagtgcttcagatgaccat
accatctgcctgtgggacatcagtgccgttccaaaggagggaaaagtggtagatgcgaag
accatctttacagggcatacggcagtagtagaagatgtttcctggcatctactccatgag
tctctgtttgggtcagttgctgatgatcagaaacttatgatttgggatactcgttcaaac
aatacttccaaaccaagccactcagttgatgctcacactgctgaagtgaactgcctttct
ttcaatccttatagtgagttcattcttgccacaggatcagctgacaagactgttgccttg
tgggatctgagaaatctgaaacttaagttgcattcctttgagtcacataaggatgaaata
ttccaggttcagtggtcacctcacaatgagactattttagcttccagtggtactgatcgc
agactgaatgtctgggatttaagtaaaattggagaggaacaatccccagaagatgcagaa
gacgggccaccagagttgttgtttattcatggtggtcatactgccaagatatctgatttc
tcctggaatcccaatgaaccttgggtgatttgttctgtatcagaagacaatatcatgcaa
gtgtggcaaatggcagagaacatttataatgatgaagaccctgaaggaagcgtggatcca
gaaggacaagggtcctag

KEGG   Homo sapiens (human): 91750Help
Entry
91750             CDS       T01001                                 

Gene name
LIN52, C14orf46, c14_5549
Definition
(RefSeq) lin-52 DREAM MuvB core complex component
  KO
K21775  protein lin-52
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    91750 (LIN52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIN52
Motif
Other DBs
NCBI-GeneID: 91750
NCBI-ProteinID: NP_001019845
HGNC: 19856
Ensembl: ENSG00000205659
Vega: OTTHUMG00000171204
Pharos: Q52LA3(Tdark)
UniProt: Q52LA3 B3KN83
LinkDB All DBs
Structure
PDB: 

Position
14q24.3
AA seq 116 aa AA seqDB search
MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAE
IERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPKK
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgggttggaagatggcgtctcccacagacgggacagatctggaagcatctttgctaagt
tttgaaaaacttgaccgtgcctcaccagatctttggccagaacaattaccaggtgttgct
gaatttgcagcttccttcaaaagtcctattactagttctccacccaaatggatggctgag
atagaacgtgatgacatcgacatgttgaaagaactggggagtctcaccacggctaatttg
atggagaaggttcgaggcctacagaacctagcctatcagctggggctggatgagtccaga
gagatgacacgggggaaattcctcaatattctagagaagcccaagaagtag

DBGET integrated database retrieval system