KEGG   Homo sapiens (human): 132864Help
Entry
132864            CDS       T01001                                 

Gene name
CPEB2, CPE-BP2, CPEB-2, hCPEB-2
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 2
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    132864 (CPEB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    132864 (CPEB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    132864 (CPEB2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     132864 (CPEB2)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     132864 (CPEB2)
   mRNA cycle factors
    P-body specific factors
     132864 (CPEB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1
Motif
Other DBs
NCBI-GeneID: 132864
NCBI-ProteinID: NP_872587
OMIM: 610605
HGNC: 21745
Ensembl: ENSG00000137449
Pharos: Q7Z5Q1(Tbio)
UniProt: Q7Z5Q1
LinkDB All DBs
Position
4p15.32
AA seq 996 aa AA seqDB search
MRDFGFGVLQTAPLRSSSPGPLFCGEAYGPYAVGSVNPLPSATPFGPLSPPPLPVTGFLE
AASPFSVPLGGGAGSPAAAASSSSPFLAHQQTMQDELLLGLTQQPARPLSGAAATEKLPD
HHPGGGTIAGVTHLLPSQDFKPSLHHPSSSSASSCCCCRTSSPQDFSKRQQQQLSSQKRK
EFSPPHLPHPPDSKPPPPPPPLHCPGRFSPPPPPAGPLLQPAQLAQRQQQQPPQQFSLLH
QQHLSPQDFAPRQRPADLPPLPQLPPSPPAAPRRRHGGAGSPRKTPAAGEGSAAESPNAG
LASSTPVNPAPGSMESPNHPLLNSPSNLLPGGALGAGAFSSLQSPDLPHPGGGGGGGGGG
PPGGGGGGGSASPPPLPGFGTPWSVQTASPPPQPQQPPPTQPQQQPPPPQQPPQPQPQPP
GSSATTPGGGSGGSLSAMPPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCTGLSVPT
SGGGGGGFGGPFSATAVPPPPPPAMNIPQQQPPPPAAPQQPQSRRSPVSPQLQQQHQAAA
AAFLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMGIPGTMNQI
SPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQDRSRMYDSLNMH
SLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDGLLDDGHSDQVGVLN
SPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFP
PKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGS
QPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQ
SYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYY
CEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgagggatttcgggtttggggtgctgcagaccgccccgctccgaagtagcagtcctggg
cccctgttctgcggcgaggcgtatggtccttacgccgtggggtccgtcaacccgctgccc
tccgccacgcccttcggcccactgtcgccaccaccgttgcctgtcaccggcttcttagag
gccgcctcccccttctccgtccccctcggcggcggcgcgggcagcccggccgccgccgct
tcctcttcctccccgttcctggcgcatcagcagaccatgcaggatgagctgcttctgggg
ctgacacagcagccggcgcggccgctttcgggggcggcggccacggagaaactccccgac
caccaccccggcggcggcacgatcgcgggtgtgacccacctcctcccctcccaggacttc
aaaccgagtctgcaccacccctcctcctcctccgcctcctcctgctgctgctgccgcacc
tcctccccgcaggacttcagtaagcggcagcagcagcagctgagcagccagaagaggaaa
gagttcagccctccccaccttccccaccctccggactcgaagccgccgccgccgcctccg
ccgctccactgccccggtcggttcagcccgccgccgccgccagccggcccgctcctccag
ccggcgcagctcgctcagcgccagcagcaacagccgccgcagcagttcagcctcctgcat
cagcagcacctctcgccgcaggacttcgccccgcggcagcgtccggcagacctgcccccg
ctcccgcagctccctccctcgccgcctgcagccccgcggcgccgccacggaggcgcgggc
agccctcgcaagaccccagccgcgggcgagggcagcgccgccgagtcccccaatgcgggc
ttggcctcctcgacgccggtgaaccccgcgccgggctccatggagtcccccaaccaccct
ctgctcaacagtcccagtaacctcctgcccggaggtgcgcttggcgcgggcgccttcagc
agcctgcagagcccggaccttccacacccgggcggcggcggcggcggcgggggcgggggg
cccccaggaggcggagggggaggcggctccgcgtcgccgccgccgctgcccggcttcggc
accccctggtcggtgcagaccgcgtcgccgccaccccagccccagcagccgccgccgacc
cagccgcagcagcagccgccgccaccccagcagccgccccagccgcagccgcagccgccc
ggctcgtctgccaccaccccgggcggcggcagcggcggctcgctcagcgccatgccgccg
cccagccccgactcagagaacggcttctaccccgggctgccgtcgtccatgaacccggcc
ttcttccctagcttctcgcccgtgtcgccgcacggctgcactgggctcagcgttccgacg
agcggcggcggcggcggcggcttcggcggccccttctcggctaccgctgtgccccctccg
ccgccgcccgccatgaatatacctcaacagcagcccccgccgcccgcggcgccgcagcag
ccgcagagccggaggtcgcccgtcagcccgcagctccagcagcagcaccaggcggcggcc
gccgccttcctgcagcagaggaactcctataaccaccaccagcctcttctgaaacagtct
ccctggagcaaccatcagagcagtggctggggcactggaagtatgtcctggggagcaatg
catggcagagatcatcgtagaaccggaaacatgggaatcccaggaactatgaatcagata
tctccattgaagaaaccgttttctggtaatgtcatagcaccaccgaaatttactcgctca
actccatcactgactccaaaatcttggattgaagataatgtgttcagaacagacaacaat
agtaatacactcttacccttacaggatcgaagtagaatgtatgacagtttgaatatgcac
tctttggaaaattcccttatcgatattatgagagcagagcatgatcctcttaagggtcga
ttgagctatccacatccaggaactgacaatctgttgatgttaaatggtcgttcttccctc
tttccaatagatgatggcttgcttgatgatggtcacagtgatcaagttggagttttaaat
tcacccacctgttattcagctcaccaaaatggagagcgaatagaacgcttctctcgaaaa
gtttttgttggtggtcttcctccagatattgatgaagatgaaataactgctagcttcaga
agatttgggcctttggtagtagattggcctcataaagcagaaagcaagtcctattttcca
ccaaaaggctatgcatttcttctctttcaagaagagagctcagttcaggcactcattgat
gcttgtattgaagaagatggaaaactctatctgtgtgtttctagccctactatcaaggac
aaaccagttcaaatacgtccttggaatttaagtgatagtgattttgtaatggatggttct
cagcctttggatccccgaaaaacaatttttgttggaggtgttcctaggccattaagggct
gtggaacttgctatgatcatggaccggctgtatggtggagtttgttatgcaggaattgat
acagatcctgagctaaaatacccaaaaggtgctgggcgagttgctttctccaatcagcag
agctatattgctgccattagtgctcggtttgttcagcttcagcatggtgatattgataaa
cgtgtggaggtaaagccatatgtgctagatgaccagatgtgtgatgaatgccagggcgca
cgctgtggtggaaaatttgctccctttttttgtgccaatgtcacttgcctgcagtattac
tgtgagttttgttgggcaaatatccactctcgtgctggacgtgagttccataagccattg
gtaaaggaaggtgctgatcgcccacgtcagatccacttccgctggaactaa

KEGG   Homo sapiens (human): 22849Help
Entry
22849             CDS       T01001                                 

Gene name
CPEB3
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 3
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    22849 (CPEB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    22849 (CPEB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    22849 (CPEB3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     22849 (CPEB3)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     22849 (CPEB3)
   mRNA cycle factors
    P-body specific factors
     22849 (CPEB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1 zf-B_box
Motif
Other DBs
NCBI-GeneID: 22849
NCBI-ProteinID: NP_055727
OMIM: 610606
HGNC: 21746
Ensembl: ENSG00000107864
Vega: OTTHUMG00000018756
Pharos: Q8NE35(Tbio)
UniProt: Q8NE35 B3KXC1
LinkDB All DBs
Structure
PDB: 

Position
10q23.32
AA seq 698 aa AA seqDB search
MQDDLLMDKSKTQPQPQQQQRQQQQPQPESSVSEAPSTPLSSETPKPEENSAVPALSPAA
APPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPAAPGASLSPSFGSTWSTGTTNAVE
DSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQHHQQPPPPAPAPQPAQPAQ
PPQAQPPQQRRSPASPSQAPYAQRSAAAAYGHQPIMTSKPSSSSAVAAAAAAAAASSASS
SWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNV
IAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTD
HEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNNAFLDDSHGDQAL
SSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSY
FPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMD
GSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSN
QQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQ
YYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgatttactgatggacaaaagcaaaacccagccccagccccagcagcagcag
cggcagcagcagcagccccaacctgagtccagcgtatccgaagccccgtccacgcccctc
tcctcagagacccccaagccggaggaaaacagcgcagtgccggccctcagcccagccgct
gcccccccggcccccaacggcccggacaagatgcagatggaatcaccgctcctgccaggc
ttgagtttccatcagcctcctcagcagccgccgccgcctcaggagcccgcggcaccgggc
gcgtcgctgtcgccgtccttcggcagcacctggtccacgggcaccaccaacgcggtagag
gacagcttcttccaggggatcaccccagtcaacgggaccatgctcttccagaacttcccg
caccatgtcaacccagtcttcggaggcactttctccccgcagatcggcctggcgcagacc
cagcaccaccagcagccgccgccgcctgcgcccgcgccgcagccggcacagccagcgcag
ccaccacaggcgcagcccccgcagcagcgccgctcacccgccagccccagccaggcgccc
tacgcgcagaggagcgccgccgcggcgtacggccaccagcccatcatgaccagcaagccg
tcctcgtcttcggcggttgcagccgctgctgccgcagccgccgcctcgtcggcctcgtcc
agctggaacacgcaccaaagcgtgaatgcagcctggagcgcaccgtccaacccctggggc
ggcctgcaggcgggccgggaccctcgccgggcggtcggtgtgggcgtgggtgtgggtgtc
ggggtgccttccccgctcaaccccatctcgccgctcaaaaagcccttctccagcaacgtg
atcgcgccgcccaagttccctcgcgcggcccctctcacttccaagtcctggatggaggat
aacgctttccggaccgataatggtaacaatctgttgccatttcaggaccggagtaggccc
tatgatacttttaacttgcactcgttggagaactccttaatggatatgataaggactgat
catgaacctctgaaaggtaaacactaccctcccagtggcccaccaatgagtttcgctgat
ataatgtggaggaatcattttgcaggacgcatggggataaatttccatcatccaggaaca
gataatattatggcacttaacaatgccttcctggatgatagccatggtgatcaagccttg
tcatctggcttaagttctcccactcgctgtcaaaatggggaacgagtagaacgctactct
agaaaggtgtttgttggaggacttcctcctgatattgatgaagatgagatcactgccagc
tttcgcaggtttggacctctcgtagtagactggcctcacaaagctgaaagcaagtcttat
tttcctcctaaaggctatgcctttctgctgttccaagaggaaagctcagtacaagctttg
atagatgcctgcctagaagaagatgggaaactctacctgtgtgtgtcaagccccaccatc
aaggacaagccagtgcaaattcgaccatggaacctaagtgacagtgactttgtaatggat
ggttctcagcctttggaccccagaaaaactatctttgttgggggagttccacgacccctt
cgagctgttgaactggcaatgatcatggaccgtttgtacggtggtgtctgctatgctggc
attgatacggacccagagctgaagtaccccaaaggtgctggccgcgtggcattctccaat
cagcagagttacattgcagccatcagcgctcgttttgtgcagcttcagcacaatgacatt
gacaaacgggttgaagtaaagccatatgtgctggatgatcagatgtgtgatgagtgccag
ggcacacgctgtggtgggaagtttgccccgttcttctgtgccaacgtcacctgtctgcag
tattactgtgaatactgctgggcgagcatacattcccgagccgggcgggagttccacaaa
ccgctggtgaaggagggaggcgaccgccctcgtcacgtcccgttccgctggagctga

KEGG   Homo sapiens (human): 64506Help
Entry
64506             CDS       T01001                                 

Gene name
CPEB1, CPE-BP1, CPEB, CPEB-1, h-CPEB, hCPEB-1
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    64506 (CPEB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    64506 (CPEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    64506 (CPEB1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     64506 (CPEB1)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     64506 (CPEB1)
   mRNA cycle factors
    P-body specific factors
     64506 (CPEB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CEBP1_N RRM_7 CEBP_ZZ RRM_1
Motif
Other DBs
NCBI-GeneID: 64506
NCBI-ProteinID: NP_085097
OMIM: 607342
HGNC: 21744
Ensembl: ENSG00000214575
Vega: OTTHUMG00000172877
Pharos: Q9BZB8(Tbio)
UniProt: Q9BZB8
LinkDB All DBs
Structure
PDB: 

Position
15q25.2
AA seq 561 aa AA seqDB search
MAFPLEEEAGRIKDCWDNQEAPALSTCSNANIFRRINAILDNSLDFSRVCTTPINRGIHD
HLPDFQDSEETVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDSSA
QSSTHSVLSMLHNPLGNVLGKPPLSFLPLDPLGSDLVDKFPAPSVRGSRLDTRPILDSRS
SSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLSLSGGGPRDPLKMGVGSRMDQEQAAL
AAVTPSPTSASKRWPGASVWPSWDLLEAPKDPFSIEREARLHRQAAAVNEATCTWSGQLP
PRNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLV
FELEKSVRSLLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQR
LDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYL
KAVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRH
SMEGLRHHSPLMRNQKNRDSS
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcccgctggaagaagaagcaggaaggataaaagattgctgggacaaccaggaa
gcacctgctctctccacgtgtagtaatgccaatatctttcgaaggataaatgccatattg
gataattctctggatttcagtagagtctgcactacacctataaaccgaggaattcatgat
catttgccagacttccaggactctgaagaaacagttacaagcaggatgcttttcccaacc
tctgcgcaagaatcttcccgtggcctcccagatgcaaatgacttgtgccttggcctgcag
tccctcagtctgacaggctgggaccgaccctggagcacccaggactcagattcctcagcc
cagagcagcacacactcggtactgagcatgctccataacccactgggaaatgtcctagga
aaaccccccttgagcttcctgcctctggatccccttgggtctgacttggtggacaagttt
ccagcaccctcagttagaggatcacgcctggacacccggcccatcctggactctcgatct
agcagcccctctgactcagacaccagtggcttcagctctggatcagatcatctctcagat
ttgatttcaagccttcgcatttctccacctctgcccttcctgtctctgtcagggggtggt
cccagagaccctttaaagatgggggtagggtctcggatggaccaagagcaagctgctctt
gctgcagtcactccctccccaaccagtgcttcaaagagatggccaggagcttctgtgtgg
ccatcctgggacctcctcgaagctcccaaagaccccttcagcatagagagagaggccagg
ctgcaccgacaagctgcagctgtgaatgaagccacctgtacctggagtggccagcttcct
ccccggaactataagaaccccatctactcttgcaaggtgtttctaggaggtgttccttgg
gatattacagaagctggattagttaacaccttccgtgtttttggctctttgagtgtggag
tggcctggtaaggatggcaagcatccccggtgtcctcccaaagggtatgtgtatctggtc
ttcgaactagagaagtctgtccgatccttgcttcaggcttgctctcatgacccgctgagc
ccagatggcctgagtgaatattatttcaagatgtccagccgaaggatgcgctgcaaggag
gtgcaggtgatcccctgggtattagccgacagtaactttgtccggagcccatctcagagg
cttgaccccagcaggacggtgtttgtcggtgctctgcatggaatgctaaatgctgaggcc
ctggcagccatcttgaacgacctatttggtggagtggtgtatgccgggattgacacagat
aagcacaagtatcccattggttctggtcgtgtgactttcaataaccaacggagttacctg
aaagcagtcagcgctgcttttgtggagatcaaaaccaccaagttcacaaagaaggttcag
attgacccctacctagaagattctctgtgtcatatctgcagttctcagcctggtcctttc
ttctgtcgagatcaggtctgcttcaaatacttctgccggagctgctggcactggcggcac
agcatggagggcctgcgccaccacagccccctgatgcggaaccagaagaaccgagattcc
agctag

KEGG   Homo sapiens (human): 80315Help
Entry
80315             CDS       T01001                                 

Gene name
CPEB4, CPE-BP4, hCPEB-4
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 4
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    80315 (CPEB4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    80315 (CPEB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    80315 (CPEB4)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     80315 (CPEB4)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     80315 (CPEB4)
   mRNA cycle factors
    P-body specific factors
     80315 (CPEB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1
Motif
Other DBs
NCBI-GeneID: 80315
NCBI-ProteinID: NP_085130
OMIM: 610607
HGNC: 21747
Ensembl: ENSG00000113742
Vega: OTTHUMG00000130541
Pharos: Q17RY0(Tbio)
UniProt: Q17RY0
LinkDB All DBs
Structure
PDB: 

Position
5q35.2
AA seq 729 aa AA seqDB search
MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSAGSAW
LFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQG
DNSSENGNGKEKIRIESPVLTGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSS
TIINEDASFFHQGGVPAASANNGALLFQNFPHHVSPGFGGSFSPQIGPLSQHHPHHPHFQ
HHHSQHQQQRRSPASPHPPPFTHRNAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWS
PGGGGYGGWGGSQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSW
MEDSLNRADNIFPFPDRPRTFDMHSLESSLIDIMRAENDTIKGRLNYSYPGSDSSLLINA
RTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFSHQNGERVERYSRKVFVGGLP
PDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDG
KLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIM
DRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPY
VLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDR
PRHISFRWN
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgggggattacgggtttggagtgctagtgcaaagcaatactgggaataaatctgctttt
ccagtcagattccatccacatctgcagcctccacaccatcaccaaaatgccacccccagc
cctgctgcttttataaataataacacagctgccaatggcagcagtgctgggtcagcttgg
ctttttcctgctccagctacccataacattcaggatgagatcttggggtcagaaaaagca
aaaagtcagcaacaggaacagcaagaccccttagaaaagcagcagctttccccaagtcca
ggtcaggaagctggaatactgcctgaaacagagaaggcaaaatcagaagaaaatcaaggg
gacaattcttcggaaaatggcaatgggaaggagaaaataaggatcgaatctccagtgttg
acagggtttgattatcaagaagccactgggctaggtacttcaacccaacccttgacatct
agcgcatcgtctcttactggtttcagtaactggtcagcagcgatagcgccttcctcctct
acaataatcaatgaagatgcaagtttctttcaccagggaggggtccctgctgcttcggct
aataacggtgctctgttgtttcaaaatttcccccatcatgtcagccctggctttggaggc
agcttctctcctcagatcgggcctctctcacagcaccacccacatcaccctcatttccag
catcatcacagccagcatcagcagcaaaggaggtctcctgccagtccccatcccccaccc
ttcacacatagaaatgctgcttttaaccagctgcctcatttggcgaataatcttaacaaa
cccccctctccgtggagcagctaccagagtccgtcaccaacaccctcctcttcctggagc
ccgggcggtggtggatatggtggctggggaggttcccaaggccgagatcaccgcagaggg
ctgaatggtggaataacgcccctgaactccatctcgcctttgaagaaaaattttgcaagc
aatcatattcagctccagaagtatgctcgccccagctctgcctttgcacctaaatcctgg
atggaagatagcttgaacagggctgacaacatttttccttttccggatcgccccaggaca
ttcgacatgcactcactggagagttcactcattgacataatgagagctgaaaatgatacc
attaaaggtcgtctaaactattcatatccaggatccgatagctctctgcttattaatgca
aggacatatgggcgaaggagaggtcagtcttcactgtttccaatggaagatggattcttg
gatgatggccgtggggatcagcctcttcatagtggcctgggttcacctcactgcttcagt
caccagaatggggaaagagtggaacgatattctcgaaaggtgtttgtaggcggattgcct
ccagacattgatgaagatgagatcacagctagttttcgtcgctttggccctctgattgtg
gattggcctcataaagctgagagcaaatcctattttcctcctaaaggctatgcattcctg
ctgtttcaagatgaaagctctgtgcaggctctcattgatgcatgcattgaagaagatgga
aaactctacctttgtgtatcaagtcccactatcaaggataagccagtccagattcggcct
tggaatctcagtgacagtgactttgtgatggatggttcacagccacttgacccacgaaaa
actatatttgttggtggtgttcctcgaccattacgagctgtggagcttgcgatgataatg
gatcggctatatggaggtgtgtgctacgctgggattgataccgaccctgagctaaaatac
ccaaaaggagctgggagagttgcgttctctaatcaacagagttacatagctgctatcagt
gcccgctttgttcagctgcagcatggagagatagataaacgggtggaagttaagccatat
gtcttggatgatcagctgtgtgatgaatgtcagggggcccgttgtggggggaaatttgct
ccatttttctgtgctaatgttacctgtctgcagtattactgtgaatattgctgggctgct
atccattctcgtgctggcagggaattccacaagcccctggtgaaggaaggcggtgaccgc
cctcggcatatttcattccgctggaactaa

DBGET integrated database retrieval system