KEGG   Homo sapiens (human): 133522
Entry
133522            CDS       T01001                                 

Gene name
PPARGC1B, ERRL1, PERC, PGC-1(beta), PGC1B
Definition
(RefSeq) PPARG coactivator 1 beta
  KO
K17962  peroxisome proliferator-activated receptor gamma coactivator 1-beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04931  Insulin resistance
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    133522 (PPARGC1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    133522 (PPARGC1B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    133522 (PPARGC1B)
SSDB
Motif
Pfam: RRM_1 DUF2052 FAM176 PGA2
Other DBs
NCBI-GeneID: 133522
NCBI-ProteinID: NP_573570
OMIM: 608886
HGNC: 30022
Ensembl: ENSG00000155846
Vega: OTTHUMG00000130055
Pharos: Q86YN6(Tbio)
UniProt: Q86YN6
LinkDB
Structure
PDB: 
6D0Y

Position
5q32
AA seq 1023 aa
MAGNDCGALLDEELSSFFLNYLADTQGGGSGEEQLYADFPELDLSQLDASDFDSATCFGE
LQWCPENSETEPNQYSPDDSELFQIDSENEALLAELTKTLDDIPEDDVGLAAFPALDGGD
ALSCTSASPAPSSAPPSPAPEKPSAPAPEVDELSLLQKLLLATSYPTSSSDTQKEGTAWR
QAGLRSKSQRPCVKADSTQDKKAPMMQSQSRSCTELHKHLTSAQCCLQDRGLQPPCLQSP
RLPAKEDKEPGEDCPSPQPAPASPRDSLALGRADPGAPVSQEDMQAMVQLIRYMHTYCLP
QRKLPPQTPEPLPKACSNPSQQVRSRPWSRHHSKASWAEFSILRELLAQDVLCDVSKPYR
LATPVYASLTPRSRPRPPKDSQASPGRPSSVEEVRIAASPKSTGPRPSLRPLRLEVKREV
RRPARLQQQEEEDEEEEEEEEEEEKEEEEEWGRKRPGRGLPWTKLGRKLESSVCPVRRSR
RLNPELGPWLTFADEPLVPSEPQGALPSLCLAPKAYDVERELGSPTDEDSGQDQQLLRGP
QIPALESPCESGCGDMDEDPSCPQLPPRDSPRCLMLALSQSDPTFGKKSFEQTLTVELCG
TAGLTPPTTPPYKPTEEDPFKPDIKHSLGKEIALSLPSPEGLSLKATPGAAHKLPKKHPE
RSELLSHLRHATAQPASQAGQKRPFSCSFGDHDYCQVLRPEGVLQRKVLRSWEPSGVHLE
DWPQQGAPWAEAQAPGREEDRSCDAGAPPKDSTLLRDHEIRASLTKHFGLLETALEEEDL
ASCKSPEYDTVFEDSSSSSGESSFLPEEEEEEGEEEEEDDEEEDSGVSPTCSDHCPYQSP
PSKANRQLCSRSRSSSGSSPCHSWSPATRRNFRCESRGPCSDRTPSIRHARKRREKAIGE
GRVVYIQNLSSDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTK
GAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQ
SLH
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggcggggaacgactgcggcgcgctgctggacgaagagctctcctccttcttcctcaac
tatctcgctgacacgcagggtggagggtccggggaggagcaactctatgctgactttcca
gaacttgacctctcccagctggatgccagcgactttgactcggccacctgctttggggag
ctgcagtggtgcccagagaactcagagactgaacccaaccagtacagccccgatgactcc
gagctcttccagattgacagtgagaatgaggccctcctggcagagctcaccaagaccctg
gatgacatccctgaagatgacgtgggtctggctgccttcccagccctggatggtggagac
gctctatcatgcacctcagcttcgcctgccccctcatctgcaccccccagccctgccccg
gagaagccctcggccccagcccctgaggtggacgagctctcactgctgcagaagctcctc
ctggccacatcctacccaacatcaagctctgacacccagaaggaagggaccgcctggcgc
caggcaggcctcagatctaaaagtcaacggccttgtgttaaggcggacagcacccaagac
aagaaggctcccatgatgcagtctcagagccgaagttgtacagaactacataagcacctc
acctcggcacagtgctgcctgcaggatcggggtctgcagccaccatgcctccagagtccc
cggctccctgccaaggaggacaaggagccgggtgaggactgcccgagcccccagccagct
ccagcctctccccgggactccctagctctgggcagggcagaccccggtgccccggtttcc
caggaagacatgcaggcgatggtgcaactcatacgctacatgcacacctactgcctcccc
cagaggaagctgcccccacagacccctgagccactccccaaggcctgcagcaacccctcc
cagcaggtcagatcccggccctggtcccggcaccactccaaagcctcctgggctgagttc
tccattctgagggaacttctggctcaagacgtgctctgtgatgtcagcaaaccctaccgt
ctggccacgcctgtttatgcctccctcacacctcggtcaaggcccaggccccccaaagac
agtcaggcctcccctggtcgcccgtcctcggtggaggaggtaaggatcgcagcttcaccc
aagagcaccgggcccagaccaagcctgcgcccactgcggctggaggtgaaaagggaggtc
cgccggcctgccagactgcagcagcaggaggaggaagacgaggaagaagaggaggaggaa
gaggaagaagaaaaagaggaggaggaggagtggggcaggaaaaggccaggccgaggcctg
ccatggacgaagctggggaggaagctggagagctctgtgtgccccgtgcggcgttctcgg
agactgaaccctgagctgggcccctggctgacatttgcagatgagccgctggtcccctcg
gagccccaaggtgctctgccctcactgtgcctggctcccaaggcctacgacgtagagcgg
gagctgggcagccccacggacgaggacagtggccaagaccagcagctcctacggggaccc
cagatccctgccctggagagcccctgtgagagtgggtgtggggacatggatgaggacccc
agctgcccgcagctccctcccagagactctcccaggtgcctcatgctggccttgtcacaa
agcgacccaacttttggcaagaagagctttgagcagaccttgacagtggagctctgtggc
acagcaggactcaccccacccaccacaccaccgtacaagcccacagaggaggatcccttc
aaaccagacatcaagcatagtctaggcaaagaaatagctctcagcctcccctcccctgag
ggcctctcactcaaggccaccccaggggctgcccacaagctgccaaagaagcacccagag
cgaagtgagctcctgtcccacctgcgacatgccacagcccagccagcctcccaggctggc
cagaagcgtcccttctcctgttcctttggagaccatgactactgccaggtgctccgacca
gaaggcgtcctgcaaaggaaggtgctgaggtcctgggagccgtctggggttcaccttgag
gactggccccagcagggtgccccttgggctgaggcacaggcccctggcagggaggaagac
agaagctgtgatgctggcgccccacccaaggacagcacgctgctgagagaccatgagatc
cgtgccagcctcaccaaacactttgggctgctggagaccgccctggaggaggaagacctg
gcctcctgcaagagccctgagtatgacactgtctttgaagacagcagcagcagcagcggc
gagagcagcttcctcccagaggaggaagaggaagaaggggaggaggaggaggaggacgat
gaagaagaggactcaggggtcagccccacttgctctgaccactgcccctaccagagccca
ccaagcaaggccaaccggcagctctgttcccgcagccgctcaagctctggctcttcaccc
tgccactcctggtcaccagccactcgaaggaacttcagatgtgagagcagagggccgtgt
tcagacagaacgccaagcatccggcacgccaggaagcggcgggaaaaggccattggggaa
ggccgcgtggtgtacattcaaaatctctccagcgacatgagctcccgagagctgaagagg
cgctttgaagtgtttggtgagattgaggagtgcgaggtgctgacaagaaataggagaggc
gagaagtacggcttcatcacctaccggtgttctgagcacgcggccctctctttgacaaag
ggcgctgccctgaggaagcgcaacgagccctccttccagctgagctacggagggctccgg
cacttctgctggcccagatacactgactacgattccaattcagaagaggcccttcctgcg
tcagggaaaagcaagtatgaagccatggattttgacagcttactgaaagaggcccagcag
agcctgcattga

DBGET integrated database retrieval system