KEGG   Homo sapiens (human): 134860Help
Entry
134860            CDS       T01001                                 

Gene name
TAAR9, TA3, TAR3, TAR9, TRAR3
Definition
(RefSeq) trace amine associated receptor 9 (gene/pseudogene)
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    134860 (TAAR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    134860 (TAAR9)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    134860 (TAAR9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 YMF19
Motif
Other DBs
NCBI-GeneID: 134860
NCBI-ProteinID: NP_778227
OMIM: 608282
HGNC: 20977
Ensembl: ENSG00000237110
Vega: OTTHUMG00000015578
Pharos: Q96RI9(Tdark)
UniProt: Q96RI9
LinkDB All DBs
Position
6q23.2
AA seq 348 aa AA seqDB search
MVNNFSQAEAVELCYKNVNESCIKTPYSPGPRSILYAVLGFGAVLAAFGNLLVMIAILHF
KQLHTPTNFLIASLACADFLVGVTVMPFSTVRSVESCWYFGDSYCKFHTCFDTSFCFASL
FHLCCISVDRYIAVTDPLTYPTKFTVSVSGICIVLSWFFSVTYSFSIFYTGANEEGIEEL
VVALTCVGGCQAPLNQNWVLLCFLLFFIPNVAMVFIYSKIFLVAKHQARKIESTASQAQS
SSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILVWCV
YYNSAMNPLIYAFFYQWFGKAIKLIVSGKVLRTDSSTTNLFSEEVETD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacaatttctcccaagctgaggctgtggagctgtgttacaagaacgtgaacgaa
tcctgcattaaaactccttactcgccaggtcctcgatctatcctctacgccgtccttggt
tttggggctgtgctggcagcgtttggaaacttactggtcatgattgctatccttcacttc
aaacaactgcacacacctacaaactttctgattgcgtcgctggcctgtgctgacttcttg
gtgggagtcactgtgatgcccttcagcacagtgaggtctgtggagagctgttggtacttt
ggggacagttactgtaaattccatacatgttttgacacatccttctgttttgcttcttta
tttcatttatgctgtatctctgttgatagatacattgctgttactgatcctctgacctat
ccaaccaagtttactgtgtcagtttcagggatatgcattgttctttcctggttcttttct
gtcacatacagcttttcgatcttttacacgggagccaacgaagaaggaattgaggaatta
gtagttgctctaacctgtgtaggaggctgccaggctccactgaatcaaaactgggtccta
ctttgttttcttctattctttatacccaatgtcgccatggtgtttatatacagtaagata
tttttggtggccaagcatcaggctaggaagatagaaagtacagccagccaagctcagtcc
tcctcagagagttacaaggaaagagtagcaaaaagagagagaaaggctgccaaaaccttg
ggaattgctatggcagcatttcttgtctcttggctaccatacctcgttgatgcagtgatt
gatgcttatatgaattttataactcctccttatgtttatgagattttagtttggtgtgtt
tattataattcagctatgaaccccttgatttatgctttcttttaccaatggtttgggaag
gcaataaaacttattgtaagcggcaaggtcttaaggactgattcgtcaacaactaattta
ttttctgaagaagtagagacagattaa

DBGET integrated database retrieval system