KEGG   Homo sapiens (human): 134860
Entry
134860            CDS       T01001                                 

Gene name
TAAR9, TA3, TAR3, TAR9, TRAR3
Definition
(RefSeq) trace amine associated receptor 9
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    134860 (TAAR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    134860 (TAAR9)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    134860 (TAAR9)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 YMF19
Other DBs
NCBI-GeneID: 134860
NCBI-ProteinID: NP_778227
OMIM: 608282
HGNC: 20977
Ensembl: ENSG00000237110
Vega: OTTHUMG00000015578
Pharos: Q96RI9(Tdark)
UniProt: Q96RI9
LinkDB
Position
6q23.2
AA seq 348 aa
MVNNFSQAEAVELCYKNVNESCIKTPYSPGPRSILYAVLGFGAVLAAFGNLLVMIAILHF
KQLHTPTNFLIASLACADFLVGVTVMPFSTVRSVESCWYFGDSYCKFHTCFDTSFCFASL
FHLCCISVDRYIAVTDPLTYPTKFTVSVSGICIVLSWFFSVTYSFSIFYTGANEEGIEEL
VVALTCVGGCQAPLNQNWVLLCFLLFFIPNVAMVFIYSKIFLVAKHQARKIESTASQAQS
SSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILVWCV
YYNSAMNPLIYAFFYQWFGKAIKLIVSGKVLRTDSSTTNLFSEEVETD
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggtgaacaatttctcccaagctgaggctgtggagctgtgttacaagaacgtgaacgaa
tcctgcattaaaactccttactcgccaggtcctcgatctatcctctacgccgtccttggt
tttggggctgtgctggcagcgtttggaaacttactggtcatgattgctatccttcacttc
aaacaactgcacacacctacaaactttctgattgcgtcgctggcctgtgctgacttcttg
gtgggagtcactgtgatgcccttcagcacagtgaggtctgtggagagctgttggtacttt
ggggacagttactgtaaattccatacatgttttgacacatccttctgttttgcttcttta
tttcatttatgctgtatctctgttgatagatacattgctgttactgatcctctgacctat
ccaaccaagtttactgtgtcagtttcagggatatgcattgttctttcctggttcttttct
gtcacatacagcttttcgatcttttacacgggagccaacgaagaaggaattgaggaatta
gtagttgctctaacctgtgtaggaggctgccaggctccactgaatcaaaactgggtccta
ctttgttttcttctattctttatacccaatgtcgccatggtgtttatatacagtaagata
tttttggtggccaagcatcaggctaggaagatagaaagtacagccagccaagctcagtcc
tcctcagagagttacaaggaaagagtagcaaaaagagagagaaaggctgccaaaaccttg
ggaattgctatggcagcatttcttgtctcttggctaccatacctcgttgatgcagtgatt
gatgcttatatgaattttataactcctccttatgtttatgagattttagtttggtgtgtt
tattataattcagctatgaaccccttgatttatgctttcttttaccaatggtttgggaag
gcaataaaacttattgtaagcggcaaggtcttaaggactgattcgtcaacaactaattta
ttttctgaagaagtagagacagattaa

KEGG   Homo sapiens (human): 134864
Entry
134864            CDS       T01001                                 

Gene name
TAAR1, TA1, TAR1, TRAR1
Definition
(RefSeq) trace amine associated receptor 1
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    134864 (TAAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    134864 (TAAR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    134864 (TAAR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 134864
NCBI-ProteinID: NP_612200
OMIM: 609333
HGNC: 17734
Ensembl: ENSG00000146399
Vega: OTTHUMG00000015583
Pharos: Q96RJ0(Tclin)
UniProt: Q96RJ0
LinkDB
Position
6q23.2
AA seq 339 aa
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgatgcccttttgccacaatataattaatatttcctgtgtgaaaaacaactggtcaaat
gatgtccgtgcttccctgtacagtttaatggtgctcataattctgaccacactcgttggc
aatctgatagttattgtttctatatcacacttcaaacaacttcataccccaacaaattgg
ctcattcattccatggccactgtggactttcttctggggtgtctggtcatgccttacagt
atggtgagatctgctgagcactgttggtattttggagaagtcttctgtaaaattcacaca
agcaccgacattatgctgagctcagcctccattttccatttgtctttcatctccattgac
cgctactatgctgtgtgtgatccactgagatataaagccaagatgaatatcttggttatt
tgtgtgatgatcttcattagttggagtgtccctgctgtttttgcatttggaatgatcttt
ctggagctaaacttcaaaggcgctgaagagatatattacaaacatgttcactgcagagga
ggttgctctgtcttctttagcaaaatatctggggtactgacctttatgacttctttttat
atacctggatctattatgttatgtgtctattacagaatatatcttatcgctaaagaacag
gcaagattaattagtgatgccaatcagaagctccaaattggattggaaatgaaaaatgga
atttcacaaagcaaagaaaggaaagctgtgaagacattggggattgtgatgggagttttc
ctaatatgctggtgccctttctttatctgtacagtcatggacccttttcttcactacatt
attccacctactttgaatgatgtattgatttggtttggctacttgaactctacatttaat
ccaatggtttatgcatttttctatccttggtttagaaaagcactgaagatgatgctgttt
ggtaaaattttccaaaaagattcatccaggtgtaaattatttttggaattgagttcatag

KEGG   Homo sapiens (human): 319100
Entry
319100            CDS       T01001                                 

Gene name
TAAR6, TA4, TAR4, TAR6, TRAR4, taR-4, taR-6
Definition
(RefSeq) trace amine associated receptor 6
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    319100 (TAAR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    319100 (TAAR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    319100 (TAAR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 319100
NCBI-ProteinID: NP_778237
OMIM: 608923
HGNC: 20978
Ensembl: ENSG00000146383
Vega: OTTHUMG00000015579
Pharos: Q96RI8(Tbio)
UniProt: Q96RI8
LinkDB
Position
6q23.2
AA seq 345 aa
MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHF
KQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSL
FHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEEL
SDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTES
SSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCA
YYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgagcagcaattcatccctgctggtggctgtgcagctgtgctacgcgaacgtgaatggg
tcctgtgtgaaaatccccttctcgccgggatcccgggtgattctgtacatagtgtttggc
tttggggctgtgctggctgtgtttggaaacctcctggtgatgatttcaatcctccatttc
aagcagctgcactctccgaccaattttctcgttgcctctctggcctgcgctgatttcttg
gtgggtgtgactgtgatgcccttcagcatggtcaggacggtggagagctgctggtatttt
gggaggagtttttgtactttccacacctgctgtgatgtggcattttgttactcttctctc
tttcacttgtgcttcatctccatcgacaggtacattgcggttactgaccccctggtctat
cctaccaagttcaccgtatctgtgtcaggaatttgcatcagcgtgtcctggatcctgccc
ctcatgtacagcggtgctgtgttctacacaggtgtctatgacgatgggctggaggaatta
tctgatgccctaaactgtataggaggttgtcagaccgttgtaaatcaaaactgggtgttg
acagattttctatccttctttatacctacctttattatgataattctgtatggtaacata
tttcttgtggctagacgacaggcgaaaaagatagaaaatactggtagcaagacagaatca
tcctcagagagttacaaagccagagtggccaggagagagagaaaagcagctaaaaccctg
ggggtcacagtggtagcatttatgatttcatggttaccatatagcattgattcattaatt
gatgcctttatgggctttataacccctgcctgtatttatgagatttgctgttggtgtgct
tattataactcagccatgaatcctttgatttatgctttattttacccatggtttaggaaa
gcaataaaagttattgtaactggtcaggttttaaagaacagttcagcaaccatgaatttg
ttttctgaacatatataa

KEGG   Homo sapiens (human): 83551
Entry
83551             CDS       T01001                                 

Gene name
TAAR8, GPR102, TA5, TAR5, TRAR5, TaR-5, TaR-8
Definition
(RefSeq) trace amine associated receptor 8
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    83551 (TAAR8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    83551 (TAAR8)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    83551 (TAAR8)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Pkr1
Other DBs
NCBI-GeneID: 83551
NCBI-ProteinID: NP_444508
OMIM: 606927
HGNC: 14964
Ensembl: ENSG00000146385
Vega: OTTHUMG00000015586
Pharos: Q969N4(Tbio)
UniProt: Q969N4
LinkDB
Position
6q23.2
AA seq 342 aa
MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFK
QLHSPTNFLIASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVL
HLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELV
SALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESS
SESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAY
YNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaccagcaatttttcccaacctgttgtgcagctttgctatgaggatgtgaatggatct
tgtattgaaactccctattctcctgggtcccgggtaattctgtacacggcgtttagcttt
gggtctttgctggctgtatttggaaatctcttagtaatgacttctgttcttcattttaag
cagctgcactctccaaccaattttctcattgcctctctggcctgtgctgacttcttggta
ggtgtgactgtgatgcttttcagcatggtcaggacggtggagagctgctggtattttgga
gccaaattttgtactcttcacagttgctgtgatgtggcattttgttactcttctgtcctc
cacttgtgcttcatctgcatcgacaggtacattgtggttactgatcccctggtctatgct
accaagttcaccgtgtctgtgtcgggaatttgcatcagcgtgtcctggattctgcctctc
acgtacagcggtgctgtgttctacacaggtgtcaatgatgatgggctggaggaattagta
agtgctctcaactgcgtaggtggctgtcaaattattgtaagtcaaggctgggtgttgata
gattttctgttattcttcatacctacccttgttatgataattctttacagtaagattttt
cttatagctaaacaacaagctataaaaattgaaactactagtagcaaagtagaatcatcc
tcagagagttataaaatcagagtggccaagagagagaggaaagcagctaaaaccctgggg
gtcacggtactagcatttgttatttcatggttaccgtatacagttgatatattaattgat
gcctttatgggcttcctgacccctgcctatatctatgaaatttgctgttggagtgcttat
tataactcagccatgaatcctttgatttatgctctattttatccttggtttaggaaagcc
ataaaacttattttaagtggagatgttttaaaggctagttcatcaaccattagtttattt
ttagaataa

KEGG   Homo sapiens (human): 9038
Entry
9038              CDS       T01001                                 

Gene name
TAAR5, PNR
Definition
(RefSeq) trace amine associated receptor 5
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9038 (TAAR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9038 (TAAR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    9038 (TAAR5)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 9038
NCBI-ProteinID: NP_003958
OMIM: 607405
HGNC: 30236
Ensembl: ENSG00000135569
Vega: OTTHUMG00000015581
Pharos: O14804(Tbio)
UniProt: O14804
LinkDB
Position
6q23.2
AA seq 337 aa
MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVS
YFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLT
SIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLS
QWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSL
AGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSAC
NPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagagctgtcttcatccaaggtgctgaagagcaccctgcggcattctgctaccaggtg
aatgggtcttgccccaggacagtacatactctgggcatccagttggtcatctacctggcc
tgtgcagcaggcatgctgattatcgtgctagggaatgtatttgtggcatttgctgtgtcc
tacttcaaagcgcttcacacgcccaccaacttcctgctgctctccctggccctggctgac
atgtttctgggtctgctggtgctgcccctcagcaccattcgctcagtggagagctgctgg
ttcttcggggacttcctctgccgcctgcacacctacctggacaccctcttctgcctcacc
tccatcttccatctctgtttcatttccattgaccgccactgtgccatctgtgaccccctg
ctctatccctccaagttcacagtgagggtggctctcaggtacatcctggcaggatggggg
gtgcccgcagcatacacttcgttattcctctacacagatgtggtagagacaaggctcagc
cagtggctggaagagatgccttgtgtgggcagttgccagctgctgctcaataaattttgg
ggctggttaaacttccctttgttctttgtcccctgcctcattatgatcagcttgtatgtg
aagatctttgtggttgctaccagacaggctcagcagattaccacattgagcaaaagcctg
gctggggctgccaagcatgagagaaaagctgccaagaccctgggcattgctgtgggcata
tacctcttgtgctggctgcccttcaccatagacacgatggtcgacagcctccttcacttt
atcacacccccactggtctttgacatctttatctggtttgcttacttcaactcagcctgc
aaccccatcatctatgtcttttcctaccagtggtttcggaaggcactgaaactcacactg
agccagaaggtcttctcaccgcagacacgcactgttgatttgtaccaagaatga

KEGG   Homo sapiens (human): 9287
Entry
9287              CDS       T01001                                 

Gene name
TAAR2, GPR58, taR-2
Definition
(RefSeq) trace amine associated receptor 2
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9287 (TAAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9287 (TAAR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    9287 (TAAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 YWFCY
Other DBs
NCBI-GeneID: 9287
NCBI-ProteinID: NP_001028252
OMIM: 604849
HGNC: 4514
Ensembl: ENSG00000146378
Vega: OTTHUMG00000015585
Pharos: Q9P1P5(Tdark)
UniProt: Q9P1P5
LinkDB
Position
6q23.2
AA seq 351 aa
MAVSSEQHELSHFKRTQTKKEKFNCSEYGNRSCPENERSLGVRVAMYSFMAGSIFITIFG
NLAMIISISYFKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVENCWYFGLTFCKIYY
SFDLMLSITSIFHLCSVAIDRFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGVVF
SEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIFAVSRKHA
HAINNLRENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLFDAL
TWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSSCFHNTILCMQKESE
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggctgtctcatcagagcaacatgaactttcacatttcaaaagaacacagacaaaaaag
gaaaaattcaattgctctgaatatggaaatagatcttgcccagaaaatgaaagatctctg
ggtgtccgagtggctatgtattcatttatggcaggatccatattcatcacaatatttggc
aatcttgccatgataatttccatttcctacttcaagcagcttcacacaccaaccaacttc
ctcatcctctccatggccatcactgatttcctcctgggattcaccatcatgccatatagt
atgatcagatcggtggagaactgctggtattttgggcttacattttgcaagatttattat
agttttgacctgatgcttagcataacatccatttttcatctttgctcagtggccattgat
agattttatgctatatgttacccattactttattccaccaaaataactattccagtcatt
aaaagattgctacttctatgttggtcggtccctggagcatttgccttcggggtggtcttc
tcagaggcctatgcagatggaatagagggctatgacatcttggttgcttgttccagttcc
tgcccagtgatgttcaacaagctatgggggaccaccttgtttatggcaggtttcttcact
cctgggtctatgatggtggggatttatggcaaaatttttgcagtatccagaaaacatgct
catgccatcaataacttgcgagaaaatcaaaataatcaagtgaagaaagacaaaaaagct
gccaaaactttaggaatagtgataggagttttcttattatgttggtttccttgtttcttc
acaattttattggatccctttttgaacttctctactcctgtagttttgtttgatgccttg
acatggtttggctattttaactccacatgtaatccgttaatatatggtttcttctatccc
tggtttcgcagagcactgaagtacattttgctaggtaaaattttcagctcatgtttccat
aatactattttgtgtatgcaaaaagaaagtgagtag

DBGET integrated database retrieval system