KEGG   Homo sapiens (human): 137492Help
Entry
137492            CDS       T01001                                 

Gene name
VPS37A, HCRP1, PQBP2, SPG53
Definition
(RefSeq) VPS37A subunit of ESCRT-I
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    137492 (VPS37A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    137492 (VPS37A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    137492 (VPS37A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    137492 (VPS37A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   137492 (VPS37A)
  Exosomal proteins of colorectal cancer cells
   137492 (VPS37A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mod_r UEV
Motif
Other DBs
NCBI-GeneID: 137492
NCBI-ProteinID: NP_689628
OMIM: 609927
HGNC: 24928
Ensembl: ENSG00000155975
Vega: OTTHUMG00000130785
Pharos: Q8NEZ2(Tbio)
UniProt: Q8NEZ2
LinkDB All DBs
Position
8p22
AA seq 397 aa AA seqDB search
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTINN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTAFPYLYSNPSGMSPYASQGFPFLPPYPPQEANRSITSLSVADTVS
SSTTSHTTAKPAAPSFGVLSNLPLPIPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVS
QLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDK
YELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEID
DFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagctggctttttcccctgaccaagagcgcctcctcctccgcggctgggtcccccggt
ggcctcaccagcctccagcagcagaagcagcgcctgatcgagtccctccggaactcacac
tccagtatagccgaaatacagaaagatgtggaatacagattgccattcaccataaacaac
ctgacaattaacattaatatattgcttcctccacagtttcctcaggaaaaaccagtgatc
agtgtttatccaccaatacgacatcacttaatggataaacaaggagtgtatgttacctct
ccattagtaaacaattttacaatgcactcagatcttggaaaaattattcagagtctgttg
gatgagttttggaagaatcctccagttttagctcctacttcaacagcatttccttatcta
tacagtaacccaagtgggatgtctccttatgcttctcagggttttccatttcttcctcca
tatcctccacaagaagcaaacaggagtatcacttctttatctgttgctgacactgtttct
tcttcaacaacaagtcataccacagccaagcctgccgctccttcatttggtgtcctttca
aatctgccattacccattcccacagtggatgcttcaataccgacaagccaaaatggtttt
gggtacaagatgccagatgtccctgatgcatttccagaactctcagaactaagtgtgtca
caactcacagatatgaatgaacaagaggaggtattactagaacagtttctgactttgcct
caactaaaacaaattattaccgacaaagatgacttagtaaaaagtattgaggaactagca
agaaaaaatctccttttggagcccagcttggaagccaaaagacaaactgttttagataag
tatgaattacttacacagatgaagtccactttcgaaaagaagatgcaaaggcagcatgaa
cttagtgagagctgtagtgcaagtgcccttcaggcaagattgaaagtagctgcacatgaa
gctgaggaagaatctgataatattgcagaagacttcttggagggaaagatggaaatagat
gattttctcagtagcttcatggaaaagagaacaatttgccactgtagaagagccaaggaa
gagaaacttcagcaggcgatagcaatgcacagccaatttcatgctccactatag

KEGG   Homo sapiens (human): 155382Help
Entry
155382            CDS       T01001                                 

Gene name
VPS37D, WBSCR24
Definition
(RefSeq) VPS37D subunit of ESCRT-I
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    155382 (VPS37D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    155382 (VPS37D)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    155382 (VPS37D)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    155382 (VPS37D)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   155382 (VPS37D)
  Exosomal proteins of colorectal cancer cells
   155382 (VPS37D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mod_r
Motif
Other DBs
NCBI-GeneID: 155382
NCBI-ProteinID: NP_001071089
OMIM: 610039
HGNC: 18287
Ensembl: ENSG00000176428
Vega: OTTHUMG00000157227
Pharos: Q86XT2(Tdark)
UniProt: Q86XT2
LinkDB All DBs
Position
7q11.23
AA seq 251 aa AA seqDB search
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLAS
NYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQ
AELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQ
PAPTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLS
PRPSQPEPPHR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgggcccgggcggcgcgggcggggccggagcccggcagcccggggcgctttggg
atcctcagcaccgggcagctccgggacctgcttcaggatgagcccaagctggaccggatc
gtgcggctcagcaggaagttccagggcctgcagctggagcgtgaggcctgcctggcctcc
aactacgcgctggccaaggagaacctggccctgcggccccgcctggagatgggccgggct
gccctggccatcaaataccaggagcttcgtgaggtggccgagaactgcgcggacaagctg
cagcgactggaggaaagcatgcatcgctggagtccccactgcgcgctgggctggctgcag
gctgagctagaagaggcggagcaggaggcagaggagcagatggagcagctgctgctcggg
gagcaaagcctggaggccttcctgcctgccttccagcgtggccgcgccctggcccacctg
aggcggacgcaggcagagaagctgcaggagctgctgcggcgtcgggagcgttctgcccag
ccggcccccacctcggctgctgatccccccaaatccttcccggctgcagctgtcctgccc
actggggccgcccgggggccaccagcagtgccccggagcctgccccccttggactcccgc
ccagtgcccccactgaagggctcccccgggtgccccctcggcccggcccccctgctgagc
cctcggccctcgcagccagagcccccccaccggtag

KEGG   Homo sapiens (human): 55048Help
Entry
55048             CDS       T01001                                 

Gene name
VPS37C
Definition
(RefSeq) VPS37C subunit of ESCRT-I
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55048 (VPS37C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55048 (VPS37C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55048 (VPS37C)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    55048 (VPS37C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   55048 (VPS37C)
  Exosomal proteins of colorectal cancer cells
   55048 (VPS37C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mod_r HLH
Motif
Other DBs
NCBI-GeneID: 55048
NCBI-ProteinID: NP_060436
OMIM: 610038
HGNC: 26097
Ensembl: ENSG00000167987
Vega: OTTHUMG00000167826
Pharos: A5D8V6(Tbio)
UniProt: A5D8V6
LinkDB All DBs
Position
11q12.2
AA seq 355 aa AA seqDB search
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDRYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPVR
PVPQGTPPVVEEQPQPPLAMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGP
LGPTYPAAQLGPRGAAGYSWSPQRSMPPRPGYPGTPMGASGPGYPLRGGRAPSPGYPQQS
PYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGPAWPGY
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagacgctgaaggataagaccctgcaggagctggaggagttgcagaatgactcggag
gcgattgaccagctggccctggagtcccctgaggtccaggacctacagctggaacgggag
atggcactggccaccaaccggagcctggcagagcggaacttggagttccagggtcccctg
gagatcagccgctcaaacctctcggatagataccaggagctccggaagctcgtggagcgg
tgccaggagcagaaggcaaagctggagaaattttcttcagcactgcagccagggaccttg
ttagaccttctgcaggtggaaggcatgaagatcgaagaagagtccgaggccatggctgag
aagttcctggagggcgaggtgcccctggaaacgttcctggagaatttttcctccatgagg
atgctgtcccacctgcgccgggttcgcgtggaaaagctccaggaagtggtgaggaagccc
agggcttcccaggagctggccggcgatgcccctccaccccgtccaccacccccggtgcgc
ccagtcccccagggaacaccccctgtggttgaagagcagccgcagccaccattagccatg
cctccctaccctttgccctacagcccatcccccagcctgcctgtgggccccactgcccat
ggagccctgccaccggcccctttcccagtagtgtcccagccctccttctacagcgggcct
ctgggccccacttacccggcagcccagcttggacccaggggtgctgcgggttactcctgg
tccccacagaggagcatgccaccccggccgggctatcctgggaccccaatgggtgcctct
gggcctgggtaccccttgcggggaggcagggcccccagtcctggttatcctcaacagtcc
ccataccccgcaacaggaggaaaacctccctacccaatacagcctcagctccccagcttt
ccaggccagccccagccctcagtgcccctgcagcccccttatccccccgggcccgcccct
ccctatgggttcccaccaccgccggggcctgcctggcctgggtattag

KEGG   Homo sapiens (human): 79720Help
Entry
79720             CDS       T01001                                 

Gene name
VPS37B
Definition
(RefSeq) VPS37B subunit of ESCRT-I
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    79720 (VPS37B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79720 (VPS37B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    79720 (VPS37B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    79720 (VPS37B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   79720 (VPS37B)
  Exosomal proteins of colorectal cancer cells
   79720 (VPS37B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mod_r
Motif
Other DBs
NCBI-GeneID: 79720
NCBI-ProteinID: NP_078943
OMIM: 610037
HGNC: 25754
Ensembl: ENSG00000139722
Vega: OTTHUMG00000168767
Pharos: Q9H9H4(Tbio)
UniProt: Q9H9H4 A0A024RBU0
LinkDB All DBs
Position
12q24.31
AA seq 285 aa AA seqDB search
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNL
LYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRL
PELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQC
PPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgggagcgaagcccggttcgccgggctgtcgctggtgcagctcaacgag
ctgctggaggacgagggccagctgacggagatggtgcagaagatggaggagacacagaat
gttcagcttaacaaagaaatgacacttgccagcaaccggagcctggcagaaggaaacctt
ttgtaccagccccagctggacacgttgaaagcacgcttgacccagaaataccaggaactc
caggttctctttgaagcctatcagataaagaagaccaaattagacagacagtctagcagt
gcttccttggagaccctgttagcacttcttcaggcagaaggggccaagattgaggaagac
actgagaacatggcagagaagtttctggatggagaacttcctctggattccttcattgat
gtctatcagagcaaacggaaactggcccacatgcgacgggtgaaaatcgagaagctccag
gagatggtcctaaaggggcagagactcccacaggccctggccccgctgccccccaggctg
cccgaactggcacctaccgccccccttccctaccctgccccagaggccagtgggcctcct
gccgttgcacctcggcgcatcccccccccaccacccccggtgcctgcgggacgcttagcc
accccgtttactgcggccatgagttcgggacaggccgtgccgtacccaggattacagtgc
ccgcccctgcccccccgcgtgggcctccccactcagcaaggattctcttcgcagttcgtg
tccccatatccgccacctctccctcagagacccccgccccggctccctccacaccagccg
ggtttcatcctccagtga

DBGET integrated database retrieval system