KEGG   Homo sapiens (human): 1376Help
Entry
1376              CDS       T01001                                 

Gene name
CPT2, CPT1, CPTASE, IIAE4
Definition
(RefSeq) carnitine palmitoyltransferase 2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04714  Thermogenesis
Disease
H00525  Disorders of mitochondrial fatty-acid oxidation
H01400  Secondary hyperammonemia
H01982  Carnitine palmitoyltransferase II deficiency
Drug target
Perhexiline (DG00334): D05442 D08340
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    1376 (CPT2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    1376 (CPT2)
  Environmental adaptation
   04714 Thermogenesis
    1376 (CPT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     1376 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf Tri3
Motif
Other DBs
NCBI-GeneID: 1376
NCBI-ProteinID: NP_000089
OMIM: 600650
HGNC: 2330
Ensembl: ENSG00000157184
Vega: OTTHUMG00000008942
Pharos: P23786(Tchem)
UniProt: P23786 A0A140VK13
LinkDB All DBs
Position
1p32.3
AA seq 658 aa AA seqDB search
MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMY
LSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNP
AKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA
RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA
ELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII
AKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELT
DALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASVYTKRCSEAFVREPSRHSAGELQQMMVECSKYHG
QLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG
GFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtgccccgcctgctgctgcgcgcctggccccggggccccgcggttggtccgggagcc
cccagtcggcccctcagcgccggctccgggcccggccagtacctgcagcgcagcatcgtg
cccaccatgcactaccaggacagcctgcccaggctgcctattcccaaacttgaagacacc
attaggagatacctcagtgcacagaagcctctcttgaatgatggccagttcaggaaaaca
gaacaattttgcaagagttttgaaaatgggattggaaaagaactgcatgagcagctggtt
gctctggacaaacagaataaacatacaagctacatttcgggaccctggtttgatatgtac
ctatctgctcgagactccgttgttctgaactttaatccatttatggctttcaatcctgac
ccaaaatctgagtataatgaccagctcacccgggcaaccaacatgactgtttctgccatc
cggtttctgaagacactccgggctggccttctggagccagaagtgttccacttgaaccct
gcaaaaagtgacactatcaccttcaagagactcatacgctttgtgccttcctctctgtcc
tggtatggggcctacctggtcaatgcgtatcccctggatatgtcccagtattttcggctt
ttcaactcaactcgtttacccaaacccagtcgggatgaactcttcactgatgacaaggcc
agacacctcctggtcctaaggaaaggaaatttttatatctttgatgtcctggatcaagat
gggaacattgtgagcccctcggaaatccaggcacatctgaagtacattctctcagacagc
agccccgcccccgagtttcccctggcatacctgaccagtgagaaccgagacatctgggca
gagctcaggcagaagctgatgagtagtggcaatgaggagagcctgaggaaagtggactcg
gcagtgttctgtctctgcctagatgacttccccattaaggaccttgtccacttgtcccac
aatatgctgcatggggatggcacaaaccgctggtttgataaatcctttaacctcattatc
gccaaggatggctctactgccgtccactttgagcactcttggggtgatggtgtggcagtg
ctcagattttttaatgaagtatttaaagacagcactcagacccctgccgtcactccacag
agccagccagctaccactgactctactgtcacggtgcagaaactcaacttcgagctgact
gatgccttaaagactggcatcacagctgctaaggaaaagtttgatgccaccatgaaaacc
ctcactattgactgcgtccagtttcagagaggaggcaaagaattcctgaagaagcaaaag
ctgagccctgacgcagttgcccagctggcattccagatggccttcctgcggcagtacggg
cagacagtggccacctacgagtcctgtagcactgccgcattcaagcacggccgcactgag
accatccgcccggcctccgtctatacaaagaggtgctctgaggcctttgtcagggagccc
tccaggcacagtgctggtgagcttcagcagatgatggttgagtgctccaagtaccatggc
cagctgaccaaagaagcagcaatgggccagggctttgaccgacacttgtttgctctgcgg
catctggcagcagccaaagggatcatcttgcctgagctctacctggaccctgcatacggg
cagataaaccacaatgtcctgtccacgagcacactgagcagcccagcagtgaaccttggg
ggctttgcccctgtggtctctgatggctttggtgttgggtatgctgttcatgacaactgg
ataggctgcaatgtctcttcctacccaggccgcaatgcccgggagtttctccaatgtgtg
gagaaggccttagaagacatgtttgatgccttagaaggcaaatccatcaaaagttaa

DBGET integrated database retrieval system