KEGG   Homo sapiens (human): 1380Help
Entry
1380              CDS       T01001                                 

Gene name
CR2, C3DR, CD21, CR, CVID7, SLEB9
Definition
(RefSeq) complement C3d receptor 2
  KO
K04012  complement receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04640  Hematopoietic cell lineage
hsa04662  B cell receptor signaling pathway
hsa05169  Epstein-Barr virus infection
Network
nt06136  Complement activation (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00463  Alternative pathway of complement activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1380 (CR2)
   04610 Complement and coagulation cascades
    1380 (CR2)
   04662 B cell receptor signaling pathway
    1380 (CR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    1380 (CR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1380 (CR2)
CD molecules [BR:hsa04090]
 Proteins
  1380 (CR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi UL45
Motif
Other DBs
NCBI-GeneID: 1380
NCBI-ProteinID: NP_001868
OMIM: 120650
HGNC: 2336
Ensembl: ENSG00000117322
Vega: OTTHUMG00000036307
Pharos: P20023(Tbio)
UniProt: P20023
LinkDB All DBs
Structure
PDB: 

Position
1q32.2
AA seq 1033 aa AA seqDB search
MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGE
KSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKT
NFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVT
YSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
FCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSI
VTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGR
MVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQ
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLT
KPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTG
SSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAV
QCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKE
TCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCH
PPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCL
RSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGV
PTCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTW
SQPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQ
WNPPLAVCRSRSLAPVLCGIAAGLILLTFLIVITLYVISKHRARNYYTDTSQKEAFHLEA
REVYSVDPYNPAS
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgcgggcctgctcggggttttcttggctctcgtcgcaccgggggtcctcggg
atttcttgtggctctcctccgcctatcctaaatggccggattagttattattctaccccc
attgctgttggtaccgtgataaggtacagttgttcaggtaccttccgcctcattggagaa
aaaagtctattatgcataactaaagacaaagtggatggaacctgggataaacctgctcct
aaatgtgaatatttcaataaatattcttcttgccctgagcccatagtaccaggaggatac
aaaattagaggctctacaccctacagacatggtgattctgtgacatttgcctgtaaaacc
aacttctccatgaacggaaacaagtctgtttggtgtcaagcaaataatatgtgggggccg
acacgactaccaacctgtgtaagtgttttccctctcgagtgtccagcacttcctatgatc
cacaatggacatcacacaagtgagaatgttggctccattgctccaggattgtctgtgact
tacagctgtgaatctggttacttgcttgttggagaaaagatcattaactgtttgtcttcg
ggaaaatggagtgctgtcccccccacatgtgaagaggcacgctgtaaatctctaggacga
tttcccaatgggaaggtaaaggagcctccaattctccgggttggtgtaactgcaaacttt
ttctgtgatgaagggtatcgactgcaaggcccaccttctagtcggtgtgtaattgctgga
cagggagttgcttggaccaaaatgccagtatgtgaagaaattttttgcccatcacctccc
cctattctcaatggaagacatataggcaactcactagcaaatgtctcatatggaagcata
gtcacttacacttgtgacccggacccagaggaaggagtgaacttcatccttattggagag
agcactctccgttgtacagttgatagtcagaagactgggacctggagtggccctgcccca
cgctgtgaactttctacttctgcggttcagtgtccacatccccagatcctaagaggccga
atggtatctgggcagaaagatcgatatacctataacgacactgtgatatttgcttgcatg
tttggcttcaccttgaagggcagcaagcaaatccgatgcaatgcccaaggcacatgggag
ccatctgcaccagtctgtgaaaaggaatgccaggcccctcctaacatcctcaatgggcaa
aaggaagatagacacatggtccgctttgaccctggaacatctataaaatatagctgtaac
cctggctatgtgctggtgggagaagaatccatacagtgtacctctgagggggtgtggaca
ccccctgtaccccaatgcaaagtggcagcgtgtgaagctacaggaaggcaactcttgaca
aaaccccagcaccaatttgttagaccagatgtcaactcttcttgtggtgaagggtacaag
ttaagtgggagtgtttatcaggagtgtcaaggcacaattccttggtttatggagattcgt
ctttgtaaagaaatcacctgcccaccaccccctgttatctacaatggggcacacaccggg
agttccttagaagattttccatatggaaccacggtcacttacacatgtaaccctgggcca
gaaagaggagtggaattcagcctcattggagagagcaccatccgttgtacaagcaatgat
caagaaagaggcacctggagtggccctgctcccctgtgtaaactttccctccttgctgtc
cagtgctcacatgtccatattgcaaatggatacaagatatctggcaaggaagccccatat
ttctacaatgacactgtgacattcaagtgttatagtggatttactttgaagggcagtagt
cagattcgttgcaaagctgataacacctgggatcctgaaataccagtttgtgaaaaagaa
acatgccagcatgtgagacagagtcttcaagaacttccagctggttcacgtgtggagcta
gttaatacgtcctgccaagatgggtaccagttgactggacatgcttatcagatgtgtcaa
gatgctgaaaatggaatttggttcaaaaagattccactttgtaaagttattcactgtcac
cctccaccagtgattgtcaatgggaagcacacaggcatgatggcagaaaactttctatat
ggaaatgaagtctcttatgaatgtgaccaaggattctatctcctgggagagaaaaaattg
cagtgcagaagtgattctaaaggacatggatcttggagcgggccttccccacagtgctta
cgatctcctcctgtgactcgctgccctaatccagaagtcaaacatgggtacaagctcaat
aaaacacattctgcatattcccacaatgacatagtgtatgttgactgcaatcctggcttc
atcatgaatggtagtcgcgtgattaggtgtcatactgataacacatgggtgccaggtgtg
ccaacttgtatcaaaaaagccttcatagggtgtccacctccgcctaagacccctaacggg
aaccatactggtggaaacatagctcgattttctcctggaatgtcaatcctgtacagctgt
gaccaaggctacctgctggtgggagaggcactccttctttgcacacatgagggaacctgg
agccaacctgcccctcattgtaaagaggtaaactgtagctcaccagcagatatggatgga
atccagaaagggctggaaccaaggaaaatgtatcagtatggagctgttgtaactctggag
tgtgaagatgggtatatgctggaaggcagtccccagagccagtgccaatcggatcaccaa
tggaaccctcccctggcggtttgcagatcccgttcacttgctcctgtcctttgtggtatt
gctgcaggtttgatacttcttaccttcttgattgtcattaccttatacgtgatatcaaaa
cacagagcacgcaattattatacagatacaagccagaaagaagcttttcatttagaagca
cgagaagtatattctgttgatccatacaacccagccagctga

DBGET integrated database retrieval system