KEGG   Homo sapiens (human): 138429Help
Entry
138429            CDS       T01001                                 

Gene name
PIP5KL1, PIPKH
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase like 1
  KO
K13712  phosphatidylinositol-4-phosphate 5-kinase-like protein 1 [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04144  Endocytosis
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    138429 (PIP5KL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    138429 (PIP5KL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     138429 (PIP5KL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 138429
NCBI-ProteinID: NP_001128691
OMIM: 612865
HGNC: 28711
Ensembl: ENSG00000167103
Vega: OTTHUMG00000020719
Pharos: Q5T9C9(Tdark)
UniProt: Q5T9C9
LinkDB All DBs
Position
9q34.11
AA seq 394 aa AA seqDB search
MAAPSPGPREVLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQ
AGLWAATQVSMDHPPTGPPSRDDFSEVLTQVHEGFELGTLAGPAFAWLRRSLGLAEEDYQ
AALGPGGPYLQFLSTSKSKASFFLSHDQRFFLKTQGRREVQALLAHLPRYVQHLQRHPHS
LLARLLGVHSLRVDRGKKTYFIVMQSVFYPAGRISERYDIKGCEVSRWVDPAPEGSPLVL
VLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHEDERGPGSSL
IFRTARSVQGAQSPEESRAQNRRLLPDAPNALHILDGPEQRYFLGVVDLATVYGLRKRLE
HLWKTLRYPGRTFSTVSPARYARRLCQWVEAHTE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccgagcccggggccccgcgaggtcctggccccctcccctgaggctggatgc
agagcagtcacctccagccggcgggggcttctctggcgcctccgagacaagcagtctcgc
ctgggcctgtttgagatcagcccggggcatgaactgcatgggatgacgtgcatgatgcag
gcagggctgtgggctgccacccaggtctccatggaccacccacccacggggccgccctcc
cgggacgatttctcggaggtcctaacccaggttcacgagggcttcgagctgggcacgctg
gccggccccgcctttgcctggctgcgccgctccctgggcctggcggaggaggactatcag
gctgccctgggccccggcggcccctacctgcagttcctcagcacctccaagagcaaggcc
agcttcttcctgtcccacgaccagcgcttcttcctgaagacccaggggcgccgagaggtg
caggctctgctcgcccacctgccccgctacgtgcagcacctgcagcggcacccgcactcg
ctgctggcgcggttgctgggagtgcacagtctgcgggtggaccggggaaagaagacgtac
ttcatcgtcatgcagagcgtcttctaccccgccggccgcatctccgagaggtatgacatc
aaaggctgcgaggtgagccgctgggtggatcccgcccctgagggcagcccccttgttctg
gtgctgaaggacctcaactttcagggcaagaccatcaacctggggccccagcggagctgg
ttcctccgccagatggaactggataccaccttcctccgggagctcaacgtgctggattac
agcctcctgatagccttccaacgtctccacgaggatgagaggggcccgggcagcagcctc
atcttccgcacggccaggtctgtgcaaggggcacagagcccggaagagtcgagagcccaa
aaccgccggctgctgcccgacgcccccaacgccctacacatcctggacgggcccgagcag
cgctatttcctgggcgtcgtggatctcgccacagtctacgggctccgcaagcggctggag
cacctgtggaagacactgcgctacccaggccggaccttctccactgtcagcccggctcgc
tacgcccgtcgcctctgccagtgggtggaggcgcacacggagtga

KEGG   Homo sapiens (human): 23396Help
Entry
23396             CDS       T01001                                 

Gene name
PIP5K1C, LCCS3, PIP5K-GAMMA, PIP5K1-gamma, PIP5Kgamma
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase type 1 gamma
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H00865  Lethal congenital contractural syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    23396 (PIP5K1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    23396 (PIP5K1C)
   04072 Phospholipase D signaling pathway
    23396 (PIP5K1C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23396 (PIP5K1C)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    23396 (PIP5K1C)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    23396 (PIP5K1C)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    23396 (PIP5K1C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    23396 (PIP5K1C)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    23396 (PIP5K1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23396 (PIP5K1C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     23396 (PIP5K1C)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    23396 (PIP5K1C)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    23396 (PIP5K1C)
 Endosome - Golgi transport
  Others
   Others
    23396 (PIP5K1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Toxin_33
Motif
Other DBs
NCBI-GeneID: 23396
NCBI-ProteinID: NP_036530
OMIM: 606102
HGNC: 8996
Ensembl: ENSG00000186111
Vega: OTTHUMG00000180870
Pharos: O60331(Tbio)
UniProt: O60331
LinkDB All DBs
Position
19p13.3
AA seq 668 aa AA seqDB search
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEAS
PAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYFPTDERSWVYSPLHYSAQAPP
ASDGESDT
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaggtaccggacgaggcggagagcgctgaggcgggggccgtgccctcggag
gcggcgtgggcggcagagagcggggcggcggcaggtttggctcagaagaaggcggcccca
acagaggttctgtccatgacggcacagccgggccctggccatgggaagaagttgggccat
cgaggtgtggacgcatccggcgaaaccacctacaagaagaccacctcctccaccctgaag
ggtgccatccagctgggcatcggctacaccgtgggccacctgagctccaagcccgaacgc
gacgtgctcatgcaggacttctacgtggtggagagcatcttcttccccagcgaaggcagc
aacctcacccccgcccaccacttccaggacttccgcttcaagacctatgcacctgtcgcc
ttccgctacttccgggagctctttgggatccggccagatgattacttgtactccctgtgc
aatgagccgctgatcgagctgtccaacccgggcgccagtggctccctcttctacgtcacc
agcgacgacgagttcatcatcaagaccgtcatgcacaaggaggccgagttcctgcagaag
ctgctccctggctactacatgaacctcaaccagaacccgcggacgctgctgcccaagttc
tatgggctgtactgcgtgcagtcggggggcaagaacatccgcgtcgtggtcatgaacaac
atcctgccccgcgtggtcaagatgcacctcaagttcgacctcaagggctccacctacaag
cggcgcgccagcaagaaggagaaggagaagagcttccccacctacaaggacctggacttc
atgcaggacatgcccgaggggctcctgctggacgccgacaccttcagcgccctggtcaag
acgctgcagcgggactgcctggtcctggaaagtttcaagatcatggactacagcctgctg
ctgggcgtgcacaacatcgaccagcacgagcgcgagcggcaggcgcagggcgcccagagc
acctcagatgagaagcggcctgtgggccagaaggcgctctactccacggccatggagtcc
atccagggtggcgccgcgcgcggggaggccatcgaatcggatgacacgatgggcgggatc
cccgctgtgaacggccgcggggagcggctgctgctgcacattggcatcatcgacatcctg
cagtcctacaggttcatcaagaaactggagcacacctggaaggccctcgtccacgatggg
gacacggtgtccgtccaccgccccagcttctatgccgagcgctttttcaagttcatgagc
aacacggtctttcggaagaactcctccctgaagtcctcgccctccaagaaggggcgcggc
ggagccttgctagctgtgaaaccgctggggcccaccgctgccttctcggccagccagatc
cctagcgagcgggaggaggcccagtacgacctgcggggggcccgcagctaccccacgctg
gaggacgaaggccggcccgacctcctgccctgcacgccaccttctttcgaagaagccact
acagcctccattgccacgactctgtcatccacatccctctccattcctgagcggtccccc
tcggagacgtcggagcagccgcggtacaggcggcgcacacagtcgtctggacaggatggc
aggccgcaggaggagccacccgcggaagaggatctgcagcagattacagtgcaggtggag
cctgcgtgcagcgtggagattgtggtccccaaagaggaggacgcaggggtggaggcttcc
ccggccggtgcctctgctgctgttgaagtagaaactgccagccaggcctcagacgaggag
ggcgcacctgccagccaggcctcggacgaggaggacgcgcccgccaccgacatctacttt
cccaccgatgagaggagctgggtgtactccccgctccactatagcgcccaggcccccccg
gcctccgacggcgagagcgacacataa

KEGG   Homo sapiens (human): 8394Help
Entry
8394              CDS       T01001                                 

Gene name
PIP5K1A
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase type 1 alpha
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8394 (PIP5K1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8394 (PIP5K1A)
   04072 Phospholipase D signaling pathway
    8394 (PIP5K1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8394 (PIP5K1A)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8394 (PIP5K1A)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8394 (PIP5K1A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8394 (PIP5K1A)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    8394 (PIP5K1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8394 (PIP5K1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     8394 (PIP5K1A)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8394 (PIP5K1A)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    8394 (PIP5K1A)
 Endosome - Golgi transport
  Others
   Others
    8394 (PIP5K1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 8394
NCBI-ProteinID: NP_001129110
OMIM: 603275
HGNC: 8994
Ensembl: ENSG00000143398
Vega: OTTHUMG00000012351
Pharos: Q99755(Tbio)
UniProt: Q99755
LinkDB All DBs
Position
1q21.3
AA seq 562 aa AA seqDB search
MASASSGPSSSVGFSSFDPAVPSCTLSSAASGIKRPMASEVLEARQDSYISLVPYASGMP
IKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIF
FPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASG
SLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIR
IVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADM
YNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALY
STAMESIQGEARRGGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWK
ALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRAGSSGNSC
ITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGET
LQMLTTSTTLEKLEVAESEFTH
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggcctcctccgggccgtcgtcttcggtcggtttttcatcctttgatcccgcg
gtcccttcctgtaccttgtcctcagcagcatctggaatcaagagacccatggcatctgag
gtcttggaagctagacaggattcttacatctcattggtgccttatgcctctggcatgccc
atcaagaaaataggccatagaagtgttgattcctcaggagagacaacatataaaaagaca
acctcatcagccttgaaaggtgccatccagttaggcattacccacactgtggggagcctg
agtaccaaaccagagcgtgatgtcctcatgcaagatttctacgtggttgagagtatcttc
tttcccagtgaagggagcaacctgacccctgctcatcactacaatgactttcgtttcaag
acctatgcacctgttgccttccgctacttccgggagctatttggtatccggcccgatgat
tacttgtattccctctgcagtgagccgctgattgaactctgtagctctggagctagtggt
tccctattctatgtgtccagcgacgatgagttcattattaagacagtccaacataaagag
gcggaatttctgcagaagctgcttccaggatactacatgaacctcaaccagaaccctcgg
actttgctgcctaaattctatggactgtactgtgtgcaggcaggtggcaagaacattcgg
attgtggtgatgaacaatcttttaccaagatcggtaaaaatgcatatcaaatatgacctc
aaaggctcaacctacaaacggcgggcttcccagaaagagcgagagaagcctcttcccaca
tttaaagacctagacttcttacaagacatccctgatggtctttttttggatgctgacatg
tacaacgctctctgtaagaccctgcagcgtgactgtttggtgctgcagagcttcaagata
atggattacagcctcttgatgtcaatccataatatagatcatgcacaacgagagccctta
agcagtgaaacacagtactcagttgatactcgaagaccggccccccaaaaggctctgtat
tccacagccatggaatccatccagggagaggctcgacggggtggtaccatggagactgat
gaccatatgggtggcatccctgcccggaatagtaaaggggaaaggcttctgctttatatt
ggcatcattgacattctacagtcttacaggtttgttaagaagttggagcactcttggaaa
gccctggtacatgacggagacactgtctcagtgcatcgcccaggcttctacgctgaacgg
ttccagcgcttcatgtgcaacacagtatttaagaagattcccttgaagccttctccttcc
aaaaagtttcggtctggctcatctttctctcggcgagcaggctccagtggcaactcctgc
attacttaccagccatcggtctctggggaacacaaggcacaagtgacaacaaaggcagaa
gtggagccaggcgttcaccttggtcgtcctgatgttttacctcagactccacctttggag
gaaatcagtgagggctcgcctattcctgaccccagtttctcacctctagttggagagact
ttgcaaatgctaactacaagtacaaccttggaaaagcttgaagttgcagagtcagagttc
acccattaa

KEGG   Homo sapiens (human): 8395Help
Entry
8395              CDS       T01001                                 

Gene name
PIP5K1B, MSS4, STM7
Definition
(RefSeq) phosphatidylinositol-4-phosphate 5-kinase type 1 beta
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
hsa05231  Choline metabolism in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8395 (PIP5K1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8395 (PIP5K1B)
   04072 Phospholipase D signaling pathway
    8395 (PIP5K1B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8395 (PIP5K1B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8395 (PIP5K1B)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8395 (PIP5K1B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8395 (PIP5K1B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    8395 (PIP5K1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8395 (PIP5K1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     8395 (PIP5K1B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8395 (PIP5K1B)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    8395 (PIP5K1B)
 Endosome - Golgi transport
  Others
   Others
    8395 (PIP5K1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 8395
NCBI-ProteinID: NP_003549
OMIM: 602745
HGNC: 8995
Ensembl: ENSG00000107242
Vega: OTTHUMG00000019976
Pharos: O14986(Tbio)
UniProt: O14986 Q7KYT6
LinkDB All DBs
Position
9q21.11
AA seq 540 aa AA seqDB search
MSSAAENGEAAPGKQNEEKTYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVV
ESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNP
GASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGG
INIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYF
DTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETPQNVPDAKRTGMQ
KVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKLLLFMGIIDILQSYRLMKK
LEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQALKASPSKKRCNSIAALKAT
SQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDLVPSTPSLFEAASLATTIS
SSSLYVNEHYPHDRPTLYSNSKGLPSSSTFTLEEGTIYLTAEPNTLEVQDDNASVLDVYL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgctgctgaaaatggagaggcagcacctggaaaacaaaatgaagaaaaaacc
tataaaaagactgcatcatctgctattaaaggtgctattcagctgggaataggatacaca
gtgggtaatctcacttccaagccagaacgagatgttcttatgcaagacttttatgtggtg
gaaagtgtgttcctacccagcgaagggagcaatctgaccccagcacatcactacccagac
tttagatttaagacatacgctccattagcattccgatatttcagagaactttttggtatc
aagcctgatgattacttgtattccatctgcagtgaacctctaatagaactgtctaaccct
ggagccagtggatccttgttttttgtgaccagtgatgatgaatttatcatcaaaacagtt
cagcacaaagaagctgagtttcttcagaagctactgccaggctattacatgaatttaaac
cagaatccaaggactcttttgccaaaattttacggactgtattgtatgcaatcaggaggc
attaatatcaggattgtggtgatgaacaacgttttgccacgctccatgagaatgcacttt
acatatgacttgaaaggctcaacgtataagcgaagagcatcccgtaaagagagagagaaa
tccaaccccacatttaaggacttagatttcctgcaagacatgcacgaagggttgtatttt
gatacggaaacatacaacgcgcttatgaaaacacttcagagagactgccgggtgctagaa
agcttcaagatcatggattatagccttctgttgggaattcatttcctggaccattccctc
aaagagaaagaggaggagaccccacaaaatgtgcctgatgctaagcggactgggatgcag
aaggttctctactcaacagccatggaatctatccagggtccagggaaatctggagatggg
ataatcacagagaacccagacacaatgggaggcattccagctaaaagccataggggagaa
aaactacttttatttatgggcattattgacattctgcaatcatataggttaatgaagaag
ttagaacattcctggaaagctcttgtttatgatggggacactgtttctgttcatagacca
agcttttatgcagacagatttcttaagttcatgaattccagagttttcaagaaaattcaa
gctttgaaggcttcaccgtctaagaaacggtgcaattcaatcgccgccctaaaggccact
tcacaggagattgtgtcctcaattagccaggaatggaaggatgagaagcgggatttgctg
actgaaggacaaagttttagcagccttgatgaagaagccctgggatcccgacacaggcca
gacctggtccctagcactccatcactgtttgaagctgcttccttggcaaccacaatttca
tcttcttccttatacgtcaatgagcactatccacacgacaggcctacactctattcaaac
agcaaagggttaccttccagttcaacatttaccttggaagaggggaccatctacttgacc
gctgagcccaacactctggaagtgcaggatgacaatgcttctgtgcttgacgtctattta
taa

DBGET integrated database retrieval system