KEGG   Homo sapiens (human): 1394
Entry
1394              CDS       T01001                                 

Gene name
CRHR1, CRF-R, CRF-R-1, CRF-R1, CRF1, CRFR-1, CRFR1, CRH-R-1, CRH-R1, CRHR, CRHR1L
Definition
(RefSeq) corticotropin releasing hormone receptor 1
  KO
K04578  corticotropin releasing hormone receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04730  Long-term depression
hsa04934  Cushing syndrome
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00324  CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Drug target
Corticorelin (DG01167): D03591 D03592<US> D03905<JP>
Emicerfont: D09610
Pexacerfont: D10022
Verucerfont: D09695
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1394 (CRHR1)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    1394 (CRHR1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1394 (CRHR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1394 (CRHR1)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    1394 (CRHR1)
SSDB
Motif
Pfam: 7tm_2 HRM Tissue_fac
Other DBs
NCBI-GeneID: 1394
NCBI-ProteinID: NP_001138618
OMIM: 122561
HGNC: 2357
Ensembl: ENSG00000120088
Vega: OTTHUMG00000178271
Pharos: P34998(Tclin)
UniProt: P34998
LinkDB
Structure
PDB: 
2L27

Position
17q21.31
AA seq 444 aa
MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgggagggcacccgcagctccgtctcgtcaaggcccttctccttctggggctgaacccc
gtctctgcctccctccaggaccagcactgcgagagcctgtccctggccagcaacatctca
ggactgcagtgcaacgcatccgtggacctcattggcacctgctggccccgcagccctgcg
gggcagctagtggttcggccctgccctgcctttttctatggtgtccgctacaataccaca
aacaatggctaccgggagtgcctggccaatggcagctgggccgcccgcgtgaattactcc
gagtgccaggagatcctcaatgaggagaaaaaaagcaaggtgcactaccatgtcgcagtc
atcatcaactacctgggccactgtatctccctggtggccctcctggtggcctttgtcctc
tttctgcggctcaggccaggctgcacccattggggtgaccaggcagatggagccctggag
gtgggggctccatggagtggtgccccatttcaggttcgaaggagcatccggtgcctgcga
aacatcatccactggaacctcatctccgccttcatcctgcgcaacgccacctggttcgtg
gtccagctaaccatgagccccgaggtccaccagagcaacgtgggctggtgcaggttggtg
acagccgcctacaactacttccatgtgaccaacttcttctggatgttcggcgagggctgc
tacctgcacacagccatcgtgctcacctactccactgaccggctgcgcaaatggatgttc
atctgcattggctggggtgtgcccttccccatcattgtggcctgggccattgggaagctg
tactacgacaatgagaagtgctggtttggcaaaaggcctggggtgtacaccgactacatc
taccagggccccatgatcctggtcctgctgatcaatttcatcttccttttcaacatcgtc
cgcatcctcatgaccaagctccgggcatccaccacgtctgagaccattcagtacaggaag
gctgtgaaagccactctggtgctgctgcccctcctgggcatcacctacatgctgttcttc
gtcaatcccggggaggatgaggtctcccgggtcgtcttcatctacttcaactccttcctg
gaatccttccagggcttctttgtgtctgtgttctactgtttcctcaatagtgaggtccgt
tctgccatccggaagaggtggcaccggtggcaggacaagcactcgatccgtgcccgagtg
gcccgtgccatgtccatccccacctccccaacccgtgtcagctttcacagcatcaagcag
tccacagcagtctga

KEGG   Homo sapiens (human): 1395
Entry
1395              CDS       T01001                                 

Gene name
CRHR2, CRF-RB, CRF2, CRFR2, HM-CRF
Definition
(RefSeq) corticotropin releasing hormone receptor 2
  KO
K04579  corticotropin releasing hormone receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04934  Cushing syndrome
Network
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00324  CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Drug target
Corticorelin (DG01167): D03591 D03592<US> D03905<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1395 (CRHR2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1395 (CRHR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1395 (CRHR2)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    1395 (CRHR2)
SSDB
Motif
Pfam: 7tm_2 HRM
Other DBs
NCBI-GeneID: 1395
NCBI-ProteinID: NP_001874
OMIM: 602034
HGNC: 2358
Ensembl: ENSG00000106113
Vega: OTTHUMG00000023218
Pharos: Q13324(Tbio)
UniProt: Q13324 A0A090N7T4
LinkDB
Structure
PDB: 
3N93 3N95 3N96

Position
7p14.3
AA seq 411 aa
MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALV
ERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVN
YLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESN
EVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIV
AWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggacgcggcactgctccacagcctgctggaggccaactgcagcctggcgctggctgaa
gagctgctcttggacggctgggggccacccctggaccccgagggtccctactcctactgc
aacacgaccttggaccagatcggaacgtgctggccccgcagcgctgccggagccctcgtg
gagaggccgtgccccgagtacttcaacggcgtcaagtacaacacgacccggaatgcctat
cgagaatgcttggagaatgggacgtgggcctcaaagatcaactactcacagtgtgagccc
attttggatgacaagcagaggaagtatgacctgcactaccgcatcgcccttgtcgtcaac
tacctgggccactgcgtatctgtggcagccctggtggccgccttcctgcttttcctggcc
ctgcggagcattcgctgtctgcggaatgtgattcactggaacctcatcaccacctttatc
ctgcgaaatgtcatgtggttcctgctgcagctcgttgaccatgaagtgcacgagagcaat
gaggtctggtgccgctgcatcaccaccatcttcaactacttcgtggtgaccaacttcttc
tggatgtttgtggaaggctgctacctgcacacggccattgtcatgacctactccactgag
cgcctgcgcaagtgcctcttcctcttcatcggatggtgcatccccttccccatcatcgtc
gcctgggccatcggcaagctctactatgagaatgaacagtgctggtttggcaaggagcct
ggcgacctggtggactacatctaccaaggccccatcattctcgtgctcctgatcaatttc
gtatttctgttcaacatcgtcaggatcctaatgacaaagttacgcgcgtccaccacatcc
gagacaatccagtacaggaaggcagtgaaggccaccctggtgctcctgcccctcctgggc
atcacctacatgctcttcttcgtcaatcccggggaggacgacctgtcacagatcatgttc
atctatttcaactccttcctgcagtcgttccagggtttcttcgtgtctgtcttctactgc
ttcttcaatggagaggtgcgctcagccgtgaggaagaggtggcaccgctggcaggaccat
cactcccttcgagtccccatggcccgggccatgtccatccctacatcacccacacggatc
agcttccacagcatcaagcagacggccgctgtgtga

DBGET integrated database retrieval system