KEGG   Homo sapiens (human): 139420
Entry
139420            CDS       T01001                                 

Gene name
PPP4R3C, FLFL3P, PPP4R3CP, SMEK3P, smk1
Definition
(RefSeq) protein phosphatase 4 regulatory subunit 3C
  KO
K17491  protein phosphatase 4 regulatory subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    139420 (PPP4R3C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    139420 (PPP4R3C)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    139420 (PPP4R3C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Regulatory subunits
     139420 (PPP4R3C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     139420 (PPP4R3C)
SSDB
Motif
Pfam: SMK-1
Other DBs
NCBI-GeneID: 139420
NCBI-ProteinID: NP_997202
HGNC: 33146
Ensembl: ENSG00000224960
Vega: OTTHUMG00000021300
LinkDB
Position
Xp21.3
AA seq 832 aa
MAGLRYSVKVYVLNEDEEWNNLGTGQVSSTYDEQFQGMSLLVRSDSDGSVILRSQIPPDR
PYGKYQETLIVWYEAENQGLVLKFQDPAGCQDIWKEICQAQGKDPSIQTTVNISDEPEED
FNEMSVISNMVVLPDCELNTLDQIADIVTSVFSSPVTDRERLAEILKNEAYIPKLLQLFH
TCENLENTEGLHHLYEIIKGILFLNEACLFEIMFSDECIMDVVGCLEYDPALDQPKRHRD
FLTNDAKFKEVIPITNSELRQKIHQTYRLQYIYDILLPVPSIFEDNFLSTLTTFIFSNKA
EIVSMLQKDHKFLYEVFAQLKDETTHDDRRCELLFFFKELCSFSQALQPQSKDALFETLI
QLGVLPALKIVMIRDDLQVRSAAAVICAYLVEYSPSRIREFIISEAHVCKDSDLFINVII
KQMICDTDPELGGAVHLMVVLHTLLDPRNMLTTPEKSERSEFLHFFYKHCMHKFTAPLLA
ATSEHNCEEDDIAGYDKSKNCPNDNQTAQLLALILELLTFCIQHHTFYIRSYILNKDLLR
KALILMNSKHTHLILCVLRFMRRMICLNDEAYNNYIIKGNLFEPVVNALLDNGTRYNMLN
SAILELFEYIRVENIKPLVSHIVEKFYNTLESIEYVQTFKGLKIKYEKERDRQSQIQKNL
HSVLQNIVVFRGTIEEIGLEEEICFMEDAGEVVMPPLEDDDEFMETKRTQEGEAVMPPLE
DDDKFTETKRTHQEGEAVMPPLEDDDEFMETKRNQEHEGKVDSPKRTSSGDFKFSSSYSA
CAAIGTGSPSGSSVVRLVDHPDDEEEKEEDEEEKEEDKEDETSPKKKPHLSS
NT seq 2499 nt   +upstreamnt  +downstreamnt
atggcaggcctgaggtacagtgtaaaagtctatgtcctgaacgaagacgaggaatggaac
aatctaggcaccggtcaggtctcatccacctatgacgagcagttccagggcatgtcgctg
cttgttcggtcagattcagatgggtcggtcatcctgcggtcacagatacctccagacagg
ccctatgggaaataccaagagacactaattgtttggtatgaagctgagaaccagggtttg
gtgctaaaattccaggacccagccggctgccaggatatttggaaagaaatttgccaagct
caaggtaaggatccgtctatccaaaccacagtgaacatttcagatgaaccagaggaagac
tttaatgaaatgtcagtaattagtaatatggttgtgctgcctgactgtgaactcaataca
cttgatcaaattgctgacatagttacctcagttttctcgtcacctgttacggatagggaa
agactggctgagatcttgaaaaatgaggcttatattccaaaactactgcaactgttccac
acttgtgaaaatctagagaatactgaaggtttacaccatttgtatgaaattattaaggga
attttgttcctcaacgaggcatgtctgtttgagataatgttttctgacgagtgtatcatg
gatgtggtgggatgccttgagtatgaccctgctttggatcagccaaaaaggcatagggac
ttcttgaccaacgatgcgaagttcaaggaagttataccaataactaactctgaacttagg
caaaaaatacatcagacatacagattacagtacatttatgacattcttttgcctgtgcct
tccatatttgaagataattttctttctacacttacaacttttattttctccaacaaggct
gagatagtaagcatgctgcagaaagatcacaaatttttgtatgaagtttttgcacagtta
aaggatgagactacacatgatgatagacggtgtgaattgctattttttttcaaggagtta
tgttcattttctcaggcattacagcctcaaagcaaggatgcactatttgaaacgttgata
cagttgggagttcttcctgctcttaaaatcgtaatgatcagggatgatttgcaagtaagg
tcagctgctgcagttatatgtgcttatctagtggagtacagtccatccaggatccgagaa
tttataatttcagaagctcacgtgtgcaaagatagtgaccttttcattaatgtaataatt
aaacaaatgatctgtgatactgatcctgagttaggaggtgctgttcatttgatggtagtt
ctgcatactctacttgatccacgcaacatgctgacaacacctgagaaaagtgaaagaagt
gaatttctacatttcttctacaaacattgcatgcataaatttacagcaccacttttggct
gccacctcagaacacaactgtgaggaggatgatatagctggatatgacaaaagcaaaaat
tgccccaatgataatcaaacagcacaactgcttgctttgatattagagctacttacattt
tgtatacaacatcatacattctacataagaagctatatcttgaacaaagacttgctaaga
aaggccttgatattgatgaattcaaagcatactcacctgattttgtgtgttcttcgcttt
atgagaaggatgatttgccttaatgatgaagcttataataattacatcatcaagggaaat
ctttttgagccagttgtaaatgctcttctagataatggaactcggtacaatatgttgaat
tcagctattcttgagctatttgaatacataagagtggaaaatatcaagcctcttgtttca
catatagttgaaaagttttataacacacttgaatcgattgaatatgttcagacattcaaa
ggattgaagattaaatatgaaaaagagagagacagacaaagtcaaatacaaaagaattta
cattctgtactgcaaaatatagtagttttcagaggtaccatagaagaaattgggctggaa
gaagaaatatgttttatggaagatgcaggagaagtagttatgccaccactggaagatgac
gatgaatttatggagaccaaaagaacccaagaaggagaagcagttatgccaccactggaa
gatgacgataaatttacggagaccaaaagaacccaccaagaaggagaagcagttatgcca
ccactggaagatgacgatgaatttatggagactaaaagaaaccaagaacatgaaggcaag
gtagactctcccaaaagaacatcttctggtgacttcaaattctcttcatcttattctgct
tgtgctgctattggaacaggtagcccaagtggtagcagtgtggttcgtttagtggatcat
ccagatgatgaagaagaaaaagaggaagatgaagaagaaaaagaggaagataaagaagat
gaaacatcccccaagaagaaacctcatcttagctcctaa

KEGG   Homo sapiens (human): 5531
Entry
5531              CDS       T01001                                 

Gene name
PPP4C, PP-X, PP4, PP4C, PPH3, PPP4, PPX
Definition
(RefSeq) protein phosphatase 4 catalytic subunit
  KO
K15423  serine/threonine-protein phosphatase 4 catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04922  Glucagon signaling pathway
Drug target
Fostriecin sodium: D04262
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    5531 (PPP4C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5531 (PPP4C)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5531 (PPP4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5531 (PPP4C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Catalytic subunits
     5531 (PPP4C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     5531 (PPP4C)
SSDB
Motif
Pfam: Metallophos STPPase_N Metallophos_2
Other DBs
NCBI-GeneID: 5531
NCBI-ProteinID: NP_001290432
OMIM: 602035
HGNC: 9319
Ensembl: ENSG00000149923
Vega: OTTHUMG00000132113
Pharos: P60510(Tbio)
UniProt: P60510 A0A024R625
LinkDB
Position
16p11.2
AA seq 307 aa
MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFY
DLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQI
TQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTI
DRKQEVPHDGPMCDLLWSDPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQL
VMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKK
PVADYFL
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcggagatcagcgacctggaccggcagatcgagcagctgcgtcgctgcgagctcatc
aaggagagcgaagtcaaggccctgtgcgctaaggccagagagatcttggtagaggagagc
aacgtgcagagggtggactcgccagtcacagtgtgcggcgacatccatggacaattctat
gacctcaaagagctgttcagagtaggtggcgacgtccctgagaccaactacctcttcatg
ggggactttgtggaccgtggcttctatagcgtcgaaacgttcctcctgctgctggcactt
aaggttcgctatcctgatcgcatcacactgatccggggcaaccatgagagtcgccagatc
acgcaggtctatggcttctacgatgagtgcctgcgcaagtacggctcggtgactgtgtgg
cgctactgcactgagatctttgactacctcagcctgtcagccatcatcgatggcaagatc
ttctgcgtgcacgggggcctctccccctccatccagaccctggatcagattcggacaatc
gaccgaaagcaagaggtgcctcatgatgggcccatgtgtgacctcctctggtctgaccca
gaagacaccacaggctggggcgtgagcccccgaggagccggctacctatttggcagtgac
gtggtggcccagttcaacgcagccaatgacattgacatgatctgccgtgcccaccaactg
gtgatggaaggttacaagtggcacttcaatgagacggtgctcactgtgtggtcggcaccc
aactactgctaccgctgtgggaatgtggcagccatcttggagctggacgagcatctccag
aaagatttcatcatctttgaggctgctccccaagagacacggggcatcccctccaagaag
cccgtggccgactacttcctgtga

KEGG   Homo sapiens (human): 55671
Entry
55671             CDS       T01001                                 

Gene name
PPP4R3A, FLFL1, KIAA2010, MSTP033, PP4R3, PP4R3A, SMEK1, smk-1, smk1
Definition
(RefSeq) protein phosphatase 4 regulatory subunit 3A
  KO
K17491  protein phosphatase 4 regulatory subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    55671 (PPP4R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    55671 (PPP4R3A)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    55671 (PPP4R3A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Regulatory subunits
     55671 (PPP4R3A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     55671 (PPP4R3A)
SSDB
Motif
Pfam: SMK-1 WH1 Ran_BP1 Collagen
Other DBs
NCBI-GeneID: 55671
NCBI-ProteinID: NP_001271209
OMIM: 610351
HGNC: 20219
Ensembl: ENSG00000100796
Vega: OTTHUMG00000171102
Pharos: Q6IN85(Tdark)
UniProt: Q6IN85 A0A024R6M2 Q8N6W1
LinkDB
Structure
PDB: 
6R8I

Position
14q32.12
AA seq 820 aa
MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEE
RFDDMSSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVC
EDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFL
TKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEI
VGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNM
GILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEH
MICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANT
TEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLAL
CALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDI
KSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR
TLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLK
TNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAA
ITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgaccgacacccggcggcgggtgaaggtgtacacgctcaacgaggaccggcagtgggac
gaccggggcaccgggcatgtgtcgtctggctacgtggagcggctgaagggcatgtccctg
cttgtcagggctgagagcgacggttctctacttttagagtcgaaaataaatcctaacact
gcataccagaaacaacaggacactctgattgtgtggtctgaagcagaaaattatgacttg
gcccttagctttcaagaaaaagctggatgtgatgaaatttgggagaaaatatgtcaggtt
caaggaaaggacccttccgtggacatcactcaggaccttgtggatgaatctgaagaggag
cgttttgatgatatgtcatcgccaggcttagaattgccatcttgtgaattaagtcgcctt
gaagaaattgcagaacttgtggcatcatctttaccttcacctcttcgtcgtgaaaaactt
gcactggcactagaaaatgagggttatattaaaaagctcctggagctttttcatgtgtgt
gaagatttggaaaatattgaaggactgcaccacttgtatgaaattatcaaaggcatcttt
ctcttgaatcgaactgctctttttgaagttatgttctctgaagaatgtataatggacgtc
attggatgtttagaatatgatcctgctttatcacaaccacgaaaacacagggaatttcta
acaaaaacagccaagtttaaagaagtgattcccatatcagatcctgagctgaaacaaaaa
attcatcagacatacagagttcagtatatacaagatatggttctaccaactccttcggtc
tttgaagaaaacatgttatcaacacttcactcttttatctttttcaataaggtagagatt
gttggcatgttgcaggaagatgaaaaatttctgacagatttgtttgcacaactaacagat
gaagcaacagatgaggaaaaaagacaggaattggttaactttttaaaagaattttgtgcg
ttttcccaaacgctacagcctcaaaacagagatgcttttttcaagactttgtcaaacatg
ggcatattaccagctttagaagtcatccttggcatggatgatacacaggtgcgaagtgct
gctactgatatattctcatacttggttgaatataatccatccatggtacgagagtttgtc
atgcaggaggcacaacagaatgatgatgatattttgctcatcaacctcattatagaacat
atgatttgtgatacagatcctgaacttggaggagcagtccagcttatgggcctgcttcga
actttagttgacccagagaacatgctagccactgccaataaaacagaaaagactgaattt
ctgggtttcttctacaagcactgtatgcatgttctcactgctcctttactagcaaataca
acagaagacaaacctagtaaagatgattttcagactgcccaactattggcacttgtattg
gaattgttaacattttgtgtggagcaccatacctaccacataaagaactacattattaat
aaggatatcctccggagagtgctagttcttatggcctcgaagcatgctttcttggcatta
tgtgcccttcgttttaaaagaaagattattggattaaaagatgagttttacaaccgctac
ataatgaaaagttttttgtttgaaccagtagtgaaagcatttctcaacaatggatcccgc
tacaatctgatgaactctgccataatagagatgtttgaatttattagagtggaagatata
aaatcattaactgctcatgtaattgaaaattactggaaagcactggaagatgtagattat
gtacagacatttaaaggattaaaactgagatttgaacaacaaagagaaaggcaagataat
cccaaacttgacagtatgcgttccattttgaggaatcacagatatcgaagagatgccaga
acactagaagatgaagaagagatgtggtttaacacagatgaagatgacatggaagatgga
gaagctgtagtgtctccatctgacaaaactaaaaatgatgatgatattatggatccaata
agtaaattcatggaaaggaagaaattaaaagaaagtgaggaaaaggaagtgcttctgaaa
acaaacctttctggacggcagagcccaagtttcaagctttccctgtccagtggaacgaag
actaacctcaccagccagtcatctacaacaaatctgcctggttctccgggatcacctgga
tccccaggatctccaggctctcctggatccgtacctaaaaatacatctcagacggcagct
attactacaaagggaggcctcgtgggtctggtagattatcctgatgatgatgaagatgat
gatgaggatgaagataaggaagatacgttaccattgtcaaagaaagcaaaatttgattca
taa

KEGG   Homo sapiens (human): 57223
Entry
57223             CDS       T01001                                 

Gene name
PPP4R3B, FLFL2, PP4R3B, PSY2, SMEK2, smk1
Definition
(RefSeq) protein phosphatase 4 regulatory subunit 3B
  KO
K17491  protein phosphatase 4 regulatory subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    57223 (PPP4R3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    57223 (PPP4R3B)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    57223 (PPP4R3B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-4
    Regulatory subunits
     57223 (PPP4R3B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Protein phosphatase 4
     57223 (PPP4R3B)
SSDB
Motif
Pfam: SMK-1 WH1 Ran_BP1 IGF2_C Diphtheria_T
Other DBs
NCBI-GeneID: 57223
NCBI-ProteinID: NP_001116436
OMIM: 610352
HGNC: 29267
Ensembl: ENSG00000275052
Vega: OTTHUMG00000129336
Pharos: Q5MIZ7(Tbio)
UniProt: Q5MIZ7
LinkDB
Position
2p16.1
AA seq 849 aa
MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEE
RFEEMPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQ
ACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHRE
FLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKV
EIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLA
KLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVI
EQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLT
NTSEDKCEKDFFLKHYRYSWSFICTPSHSHSHSTPSSSISQDNIVGSNKNNTICPDNYQT
AQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGL
KDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVENFY
KALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNED
EEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSA
SAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVGLVDYPDDEEEDEEEESS
PRKRPRLGS
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgtcggatacgcggcggcgagtgaaggtctataccctgaacgaagaccggcaatgggac
gaccgaggcaccgggcacgtctcctccacttacgtggaggagctcaaggggatgtcgctg
ctggttcgggcagagtccgacggatcactactcttggaatcaaagataaatccaaatact
gcatatcagaaacaacaggatacattaattgtttggtcagaagcagagaactatgatttg
gctctgagttttcaggagaaagctggctgtgatgagatctgggaaaaaatttgtcaggtt
caaggtaaagacccatcagtggaagtcacacaggacctcattgatgaatctgaagaagaa
cgatttgaagaaatgcctgaaactagtcatctgattgacctgcccacatgtgaactcaat
aaacttgaagagattgctgacttagttacctcagtgctctcctcacctatccgtagggaa
aagctggctctcgccttggaaaatgaaggctatattaaaaaactattgcagctgttccaa
gcttgcgagaacctagaaaacactgaaggcttacaccatttgtatgaaattattagagga
atcttattcctaaataaggcaactctttttgaggtaatgttttctgatgagtgtatcatg
gatgtcgtgggatgccttgaatatgaccctgctttggctcagccaaaaagacatagagaa
ttcttgaccaaaactgcaaagttcaaggaagttataccaataacagactctgaactaagg
caaaaaatacatcagacttacagggtacagtacattcaggacatcattttgcccacacca
tctgtttttgaagagaattttctttctactcttacgtcttttattttcttcaacaaagtt
gagatagtcagcatgttgcaggaagatgagaagtttttgtctgaagtttttgcacaatta
acagatgaggctacagatgatgataaacggcgtgaattggttaattttttcaaggagttt
tgtgcattttctcagacattacaacctcaaaacagggatgcatttttcaaaacattggca
aaattgggaattcttcctgctcttgaaattgtaatgggcatggatgatttgcaagtcaga
tcagctgctacagatatattttcttatctagtagaatttagtccatctatggtccgagag
tttgtaatgcaagaagctcagcagagtgatgacgatattcttcttattaatgtggtaatt
gaacaaatgatctgtgatactgatcctgagctaggaggcgctgttcagttaatgggactt
cttcgtactctaattgatccagagaacatgctggctacaactaataaaaccgaaaaaagt
gaatttctaaattttttctacaaccattgtatgcatgttctcacagcaccacttttgacc
aatacttcagaagacaaatgtgaaaaggatttttttttaaaacattacagatatagttgg
agtttcatatgtaccccttcacattcccattcccattctaccccctcttcctccatctct
caagataatatagttggatcaaacaaaaacaacacaatttgtcccgataattatcaaaca
gcacagctacttgccttaattttagagttactcacattttgtgtggaacatcacacatat
cacataaaaaactatattatgaacaaggacttgctaagaagagtcttggtcttgatgaat
tcaaagcacacttttctggccttgtgtgcccttcgctttatgaggcggataattggactt
aaagatgaattttataatcgttacatcaccaagggaaatctttttgagccagttataaat
gcacttctggataatggaactcggtataatctgttgaattcagctgttattgagttgttt
gaatttataagagtggaagatatcaagtctcttactgcccatatagttgaaaacttttat
aaagcacttgaatcgattgaatatgttcagacattcaaaggattgaagactaaatatgag
caagaaaaagacagacaaaatcagaaactgaacagtgtaccatctatattgcgtagtaac
agatttcgcagagatgcaaaagccttggaagaggatgaagaaatgtggtttaatgaagat
gaagaagaggaaggaaaagcagttgtggcaccagtggaaaaacctaagccagaagatgat
tttccagataattatgaaaagtttatggagactaaaaaagcaaaagaaagtgaagacaag
gaaaaccttcccaaaaggacatctcctggtggcttcaaatttactttctcccactctgcc
agtgctgctaatggaacaaacagtaaatctgtagtggctcagataccaccagcaacttct
aatggatcctcttccaaaaccacaaacttgcctacgtcagtaacagccaccaagggaagt
ttggttggcttagtggattatccagatgatgaagaggaagatgaagaagaagaatcgtcc
cccaggaaaagacctcgtcttggctcataa

DBGET integrated database retrieval system